SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0123474 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0123474
Domain Number 1 Region: 526-629
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000357
Family Third domain of FERM 0.012
Further Details:      
 
Domain Number 2 Region: 418-525
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000445
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  FBpp0123474
Domain Number - Region: 175-203,230-290
Classification Level Classification E-value
Superfamily ARM repeat 0.0135
Family Clathrin adaptor core protein 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0123474   Gene: FBgn0097289   Transcript: FBtr0124982
Sequence length 640
Comment type=protein; loc=scaffold_13417:complement(1093784..1093951,1094026..1095162,1095330..1095561,1095633..1096018); ID=FBpp0123474; name=Dana\GF20282-PA; parent=FBgn0097289,FBtr0124982; dbxref=FlyBase:FBpp0123474,FlyBase_Annotation_IDs:GF20282-PA; MD5=cd9f256b655b250b667a5cb4dd67f748; length=640; release=r1.3; species=Dana;
Sequence
MQSLHHQQSELHHHLQQQQQLEQEALEEQQLASEHQQHQQQQQHQQQRFLKQQSYLHSAR
KSNAGQQPSSLTNGQSHHQQQQQQEQLHQSLPHHDLDANYLQDESNGGTPPSVTKYSLLQ
FAMQHFRNDQLRDADRHHERHQSAANRSYAELVKWQGHAIRLPLLRLPNDLAPLALECFD
CILRYCGDIPLDPDLTEVKCVYTVLMHCHKYLALRDEVYCQLMKQTTANRSPCPDSSQRA
WRLLSILAAYFGCSDALRPYLMEHLTSAASDRRRSCHGTAAVCLTNLRKTARCGGRKNVP
SVEEVTAVSAGRSARRQIYRLPGGAERVVNTRCSTVVADVIAELCALLGVESEAEQQEFS
LYCIVQGDAFTMPLAADEYILDVTTELLKSGQPFYLIFCRSVWHFALKREPAPLPLYVEV
LFNQVAPDYLEGLLLELPGNGVPVPEMVRDMARIAALLHRAADLSHVPAMKEIKFLLPKP
ALGIREIRPAQWVGLVQSAWPQVAGLSPGQVKAQFLNVLAAWPLFGSSFFAVKRIWAEEG
PHVEDSPMWRDLILALNRRGVLFLDPNTHETLQHWSFMEVISTRKVRSEDGALFLDMKVG
NLMQQRVIRVQTEQAHEISRLVRQYITMAQISQRDKRELN
Download sequence
Identical sequences 7217.FBpp0123474 FBpp0123474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]