SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0123853 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0123853
Domain Number 1 Region: 127-182,242-292
Classification Level Classification E-value
Superfamily Second domain of FERM 1.48e-16
Family Second domain of FERM 0.0047
Further Details:      
 
Domain Number 2 Region: 296-441
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000043
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 40-127
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000031
Family First domain of FERM 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0123853   Gene: FBgn0097667   Transcript: FBtr0125361
Sequence length 1451
Comment type=protein; loc=scaffold_12943:complement(4800407..4801017,4801081..4804507,4804578..4804657,4810211..4810356,4810418..4810509); ID=FBpp0123853; name=Dana\GF20661-PA; parent=FBgn0097667,FBtr0125361; dbxref=FlyBase:FBpp0123853,FlyBase_Annotation_IDs:GF20661-PA; MD5=bfdeb7918df4a1073a58c21dfa7b65fe; length=1451; release=r1.3; species=Dana;
Sequence
MRAFCTVSAPLEVCASSAEQLSPGSRFLALRLLGQQQPKTLYFLVDAKSRVREVYTQTCL
HFATQGMLDTELFGLAVLIDGEYMFADPESKLSKYGPKSWRSSHTHGLDANGRPLLELHF
RVQFYIESPFMLKDETSRHNYYLQLRHNILQRDLPKEQAEQALVFLAGLALQADLGDAPP
GGKDDSGEEASSSGGGGGLSSTTTLPKISKRANERMLRLSTYVASTSKRDTTAPPPPTLP
PNGADYFRIEDYLPGGLHTPWARSAMRACHREHLGMATSMAELLYIQQACSLHETINAHT
YRMRLAKSEPGSGSAWFVVYAKGIKILGGDPSSSTPTSSATEPTTFLWPNITKLSFERKK
FEIRSGESRITLYAASDEKNKLLLTLCKDTHQWSMKLAARLKEVSKREEEEAAESQRLHA
SYACSRSLLLPYKSKNEQRISVISSTSSNTTSGIVSDRVHSEDELEIMINTPPAPLAAPS
TESLALAHLLDRPSVSRQTSSVGQMSLKDLEEQLAALSVRPAEVNNANSSLSNSIIVPRS
SIGGGGSGTALGGSGNANDSSTTTTDSPSSQHNIGSQCSSTCSTVVVTSPANTGAGGSTA
PVPVHSTSSSLELGFSHTAQNSALSETNPEDFREETESVSGVSGVYTLAHGAPPTETSGV
YTMHSSELTGQSSEMAESEKSSHYGMFQPSKLEDSHVQHPESGDGSREKQRTEFRLRSDS
NISTGSSFRGDGSDPTDNKHSLLSADELTNLIVGRGTYPSRKTVSSSLHSDCDYVTLETE
KEEHQELPPAPPPPYTARHEKTGLCGPPIAKPVVPKPIAVVPPKPEVSAPVPALPVQPPP
AVPALRRRDPPPYPSSSKPRPTSLISVSSSANPAPSIAGSMSSLKSEEVTARFITTRPQI
SILKAHTSLIPDGAKPSYAAPHHCSSAASSSGSVCSHQLSQQSLHNSNYAGGSQASLHHH
PHHHVPPAHHRHSGSAAIGIPIVPYGLHKSTASLHHQTHPSCVLLPVIKPRQFLPPPPPS
LPRQPPPPPPSNHPHLAGHLYGRELARKQLELYQQQLYSDVDYVIYPIQDPAVSQQEYLD
AKQGSLLAAMAQAAPPPPHHPYLAMQVSPAIYRSTPYLPLALSTHSRYASTQNLSDTYVQ
LPGHAAGYSPLYSPSMASLCSSYEPPPPPPLHPAALAAAASAAAASGTGPSGSSSSSMFA
RSRSDDNILNSLDSLPKGRRLPPPPPPPYVNRRLKKPPMPAPSEKPPPIPSKPSPGTTCL
LPPRKPPTLNPHSANSPLIKTSSGAQWAGERPRPDMGLGLSRGSNSILAQLQASMAAAGS
QAQAHAQAQALDIALLREKSKHLDLPLISALCNDRSLLKQTMVNPKTGQEMPMPLASSSS
ASQPGHSTTNSSNSSPGSGTLSKSRKGSTTVSHRHPQDKLPPLPVQQLAEANNYVMEPAV
MMKQQQQHKTG
Download sequence
Identical sequences B3MUH3
XP_001965368.1.52611 FBpp0123853 7217.FBpp0123853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]