SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0124236 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0124236
Domain Number 1 Region: 542-904
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.35e-114
Family Histone deacetylase, HDAC 0.000000728
Further Details:      
 
Domain Number 2 Region: 108-470
Classification Level Classification E-value
Superfamily Arginase/deacetylase 2.3e-101
Family Histone deacetylase, HDAC 0.00000312
Further Details:      
 
Domain Number 3 Region: 997-1093
Classification Level Classification E-value
Superfamily RING/U-box 1.53e-25
Family Zf-UBP 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0124236   Gene: FBgn0098049   Transcript: FBtr0125744
Sequence length 1142
Comment type=protein; loc=scaffold_13117:complement(1449707..1450095,1450332..1450419,1450582..1451223,1451281..1452694,1452741..1453024,1453488..1453671,1453738..1453868,1453937..1454230,1454904..1454906); ID=FBpp0124236; name=Dana\GF21044-PA; parent=FBgn0098049,FBtr0125744; dbxref=FlyBase:FBpp0124236,FlyBase_Annotation_IDs:GF21044-PA; MD5=80e1eedd3ac83859081c6cfad3428570; length=1142; release=r1.3; species=Dana;
Sequence
MSPPIVTRRSAQQAKIQTRAMVNKTKTSTGGGTTSAATAAGVIGSAAGGGSGGPSGGDSR
KSNKPSAALLEAKRRARNLLKSQNNAMATQECVTDIFQNAVNAKGLVRRPTALIYDESMS
QHCCLWDKEHYECPERFTRVLERCRELNLADRCLQLPSRAATKAEVLRLHTEEHFDRLKA
TSGIRDDDRMEELSSRYDSIYIHPSTFELSLLATGSTIELVDQLIAGSAQNGMAIIRPPG
HHAMKAEFNGYCFFNNVALAAQHALDVHKLQRILIIDYDVHHGQGTQRFFYNDPRQVNTV
LYFSIHRFEYGSFWPHLHESDYHAIGSGPGTGYTFNVPLNSTGMTNGDYLAIFQQLLLPV
ALEFQPELIMVSAGYDAALGCPEGEMEVTPACYPHLLNPLLRLADSKVAVVLEGGYCLDS
LAEGAALTLRSLLGDPCPPLVEELALPRQELADALLNCICAHRPHWRCLQIQKTYEADEL
MATDAVQPKDLHRVRRIWIGGPPPVERYPTRDTAIPLPAEKIASNSARLQVLRAETKLSV
PPVRVCYAYDTQMLQHCNLHDGGHPEQPFRIQSIHQMHKEYALLERMKQLSARAATTDEI
CLAHTRSHVNSVRRLLGRDPEELHQLGSTYNSVYLHPRTFDCATLAAGSVLQAVDSVLRG
ESRSGICNVRPPGHHAEPDQPHGFCIFNNVAIAAQYAIRDYGLQRVLIVDWDVHHGNGTQ
HIFESNPKVLYVSVHRYEHGAFFPKGPDGNFDVVGKGAGRGFNVNIPWNKKGMGDLEYAL
AFQQVIMPIAYEFNPQLVLVSAGFDAAIGDPLGGCKVTPEGYGMLTHWLSALAGGKIVVC
LEGGYNVNSISYAMTMCTKTLLGDPVPTPQLGAASLQKPATVAYQSCIETLQACLEVQRA
HWQSLEFAGRRLPRDFDPLVGENNNEDFLTASLRQLNISSDQIPEAAPGGPGGDRPDCGE
ERPSGSKPKVKVKTLTEYLQENKEALENNEMFAVYPLKTCPHLSLLRPEEVPPSINTGAA
CSQCESSEENWMCLSCRTVACGRYVNEHMQMHCLESEHPLAMSLRDFSVWCYACSSYIDH
PRLYAFLNAAHLDKFREPMAWTHVCPQRADGCYPIGADGRDEDDSAAGCSNICIQLERNQ
NN
Download sequence
Identical sequences FBpp0124236 7217.FBpp0124236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]