SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0125248 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0125248
Domain Number 1 Region: 640-749
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-29
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 1224-1347
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-22
Family Second domain of FERM 0.0047
Further Details:      
 
Domain Number 3 Region: 752-865
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000155
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1126-1203
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000207
Family Ubiquitin-related 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0125248   Gene: FBgn0099055   Transcript: FBtr0126756
Sequence length 1572
Comment type=protein; loc=scaffold_12929:complement(453662..454954,455026..455367,455594..455689,457070..457279,457344..457456,457516..457798,457862..458284,459496..459956,460328..461825); ID=FBpp0125248; name=Dana\GF22056-PA; parent=FBgn0099055,FBtr0126756; dbxref=FlyBase:FBpp0125248,FlyBase_Annotation_IDs:GF22056-PA; MD5=37eb406a84064017cd478d4803768186; length=1572; release=r1.3; species=Dana;
Sequence
MEQRLSEWPKPPPPQQQQQQAQHQHQLSHPHPHPQEQPRSNSSPSHQVGLPTVGGVGGVG
GGGGSGVATPPIQEAEKTITSLEIQVEEQRQLRLHDARQIEAKAAKIKEWVNNKLRDLEE
QNQLLREQNIKCNQQLELLKNHIANQSQRHSIVGPVRNSLSLDVQDFAGGSGVGVGGSNP
EHRRRSESLDPQEIIGRPLTSSYPHHQHRRNLSMEPQELERNLVAAVDGLTLAPLSSISS
KAPGSVTSSGARPDSSDTDTAHDYAEIYTPSCEKLPAWMKNNPALMASGGNSSTTTTTTS
ELGVPRPPTPPLHRFPSWEAKIYQVANDGLAGTGGTSTAESTTSQEPDIQEGTTGGGAGE
TGTGTGTSLSNGRRHGHNTGDGHGTLGSTPGTPLPPSRQQQTASGGFCDISVPVYATVKG
RASQIRSMPFTGDSSDDSSDGEDHAVMLTHHSHNSSSTDNTETSTSGSASSPSKSLKTSS
SLSPAKRSGSESPKNAKARVQLQPRTSITHTTSQHLQPHSLPHHHLHHHHHHTLPHNHNN
HHNLNLNHNHPFQGAQTTLLVTPSNGQNTLPRPRTPTRRNHGPLLPNHQAPLLQHMRGTV
ISDLSFESGLSDDYALPPDAVSESTCMDASMPSLLMRQSYVDSPSKKIESLEKMGHLAKL
GGKLKTWRKRWFVLKNGSLNYWKSQHDVQRKPQGQIQLDEACRINRAEGASTFEIDTGKK
VYYLTADSHATMDDWIRVLQNVQRRNATKLLLSRDDQKPTVQGWVTKVKNGHAKKCWCVL
LGKMFLYFKAPAETNPLGQINMRDARVEEVEHVSDSDSEEREDAAQDQARLTVAIYPAHQ
GPTYLILSGKPERDNWLYHLTVVSGGGPSAGTQYEQLVQKLMETDGDPNCVLWRHPILLH
TKDTITAPLSSMHTETMQPEAIKLFKSIQLFMSVAVNQPGIDYHVVLAQNALQHALDMPE
LQTEMICILIKQTSRHMGQKLSVGVQVNKKLGKQTRQLLLCATQSLFTCDTQQAGHAQAN
GSSPTSIQAPAATPIIDCKSNPPAYSFVQGWQLLALAVSLFVPRSSRLLWYLKLHLSRNA
DSKTETGKYAAYCERALERTLKNGGRETKPSRMEVLSILLKNPYHHSLPHAIPVHMMNST
YQVVSFDGSTTIEEFQATLAHELGTRDATNGFCLFSDDPIEKDLEHYLEPLAKLCDVISK
WETALREKGSGKFENSRVIQLSYKNRLYWKHTIKCETDKERLLLCYQTNAQIVQGRFPLS
RELALELASLMSQIDMGDYSLEKSRDVGVGLKGLDKFYPYRYRDALGAEQLKDVQELLVS
KWMLLKGRSTLDCVRIYLTCCRKWPYFGACLFQAKPRQSETSSAGTSPVAWLAVAEDALN
VLELSTMAPVARYPYSSVMTFGGCQDDFMLVVSHDDGGGCEQKLLFAMSKPKILEITLLI
ADYMNALGHTVPGTPQMNSLTRNGSHRSLRTSQRPTTAGGGSGATVAGGVGTGFSTNATT
TAHNTLNSHATHTLNSNHSHTLSSSHHAGGGGSQPGTLSSGHHHPHHLHHHQQQQHHQPD
ILKSTPDHQRIK
Download sequence
Identical sequences FBpp0125248 7217.FBpp0125248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]