SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0126884 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0126884
Domain Number 1 Region: 87-464
Classification Level Classification E-value
Superfamily L domain-like 7.82e-55
Family Ngr ectodomain-like 0.0042
Further Details:      
 
Domain Number 2 Region: 372-697
Classification Level Classification E-value
Superfamily L domain-like 8.16e-51
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 3 Region: 1074-1217
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-42
Family Toll/Interleukin receptor TIR domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 810-950
Classification Level Classification E-value
Superfamily L domain-like 1.96e-31
Family Ngr ectodomain-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0126884   Gene: FBgn0100686   Transcript: FBtr0128392
Sequence length 1403
Comment type=protein; loc=scaffold_13337:complement(17751824..17751971,17759622..17763685); ID=FBpp0126884; name=Dana\GF23692-PA; parent=FBgn0100686,FBtr0128392; dbxref=FlyBase:FBpp0126884,FlyBase_Annotation_IDs:GF23692-PA; MD5=818418637fe33106ba38c83eae427d5e; length=1403; release=r1.3; species=Dana;
Sequence
MLATSHMLYVLIATWVMPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELE
NTNFSVIQPHNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRG
LHELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQH
LNASYNKIQDISNFYFSASLSSRKARVCGTTLQSLDLSANKMVSLPSAMLSALGRLTNLN
MAKNSMSFLADRAFEGLLSLKVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPG
IFGELAELLVLDLASNELTSQWINAATFVGLKRLMMLDLSYNKISRLEAHIFRPLASLQI
LKLEENYIDQLPAGIFADLTNLHTLILSHNRISVVEQRTLQGLNNLLVLSLDNNRISRLE
QRSLVNCSQLQDLHLNGNKLQTVPEALAHVPLLKTLDVGENMISQIENTSLTQLENLYGL
RMTENPLTHIRRGVFDRMASLQILNLSGNKLKSIEAGSLQRNVQLQAIRFDGNQLKSIDG
LFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNHFQIENELSLTTFDA
SYNLLTEITSNSIPNSVEVLYLNDNQISSIQPYTFFKKPNLTRVDLVRNRLTTLEPNALR
LSPIAEDREIPEFYIGHNAYECDCNLDWLQKVNRESRTQPQLMDLDQIHCRLAYARGSSH
VSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCFCYHDQSWTSNVVDCSRAT
YDQALPSHIPMDATQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEILHNRTFYGLLE
LEVLQLQSNQLTALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIT
SFAVWNFLPSYLNELRLAGNPWSCNCEFIDKMKDFMNRHEYVADRQKMKCEAISGNTTQQ
MVLYPGGSGAEATPLPVVQCSQTLPLGLDNNYIYAEQAVSGGNASNATSTKMILNQPPKQ
DYIPILVAILTGFIFVMICTLLVFIFRQEMRVWCHSRYGVRLFYNAHKDVDKNEREKLFD
AFVSYSSKDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMV
VSENFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWG
DKLFWQKLRFALPDVSSSQRSNAGGVGGNQGCHVPINHAAYHHHHHIHQQPLPLPHPPHH
HHQQQFMLPPPPQQPGSFRRQPSLQHQQQQQLRGANATQQQQQQQQQQQQAALLMGGGSV
GGPAPQMIPLAGGIQQQSLPPPPTQPTPASRNLHIELGRRNAQTEMETETQMEDPLASFQ
IRHDQASRSPITDQRSLGSHLPI
Download sequence
Identical sequences FBpp0126884 7217.FBpp0126884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]