SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0128095 from Drosophila ananassae 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0128095
Domain Number 1 Region: 610-807,866-942
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.33e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000207
Further Details:      
 
Domain Number 2 Region: 123-227
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-32
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 3 Region: 225-347
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-23
Family Third domain of FERM 0.001
Further Details:      
 
Domain Number 4 Region: 480-574
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-21
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 5 Region: 33-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 1e-16
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0128095   Gene: FBgn0101895   Transcript: FBtr0129603
Sequence length 954
Comment type=protein; loc=scaffold_13337:join(296161..296313,296608..296715,296782..296874,296929..297070,297129..297409,297476..297984,298038..298723,298835..299459,299525..299702,299768..299857); ID=FBpp0128095; name=Dana\GF24903-PA; parent=FBgn0101895,FBtr0129603; dbxref=FlyBase:FBpp0128095,FlyBase_Annotation_IDs:GF24903-PA; MD5=968eabe43f65420451407ae205dc5d09; length=954; release=r1.3; species=Dana;
Sequence
MFERFRLSNLSKNIRLRAGGPELARDKKNPQRQQCVTVLFLDDITHTFRIERRAKGSELL
EQVFQYLELSERDYFGLLFPQKPGDVVRWVDAQKQFKKQCSSVPIDNDSVPLLEFRVKFF
VSDPSRLQEEFTRYQFYLQIKRHILSGILPCSNNTQCLLASYTVQSEFGDFNATEHQPGY
LSSLQLLSEQTVEAERKVGELHKLHRGQLPADAEYNYLEHAKRLELYGIDLHKATDSNGK
ELQLGVSAVGLLVFQHSLRLRRELSENYDTLLGFGMCSHKHAKALWKSCVEHHSFFRLKR
PHRLSRFLNMSLGSKFYYSGRTELQAVQDSKQRGRIHKVFVRSPSKRLLGAAGTAGLASG
ASGSSGGTPLQNSGSESATSHNGRPSAGGTILTITKTSRPHDNKVTSKEAESKPRKAWEQ
QSDEYDIQLDVGFIEQCTRRYESATPSPMPPAYSSGKHSPLLIPTTIADAVGQQQPDSGS
DLITIRLQADEQGRYGFNVKGGVDLNLPVLVSKVVPHTPADRCTPRVCEGDEVLMINGRD
VHGLRHEQVVAMIRECRHQPSGELLLTVRPHRSVPLLYEEEPLYQYVPESDEIGSHSNLL
DGDALFTQSLLLLSDGLASGALLAQYELMYRKNPDLAITEARKPINAAKNRYRDISPYDC
TRVSLINSLTGDYINANYVNMEIPGGAVNRYIATQGPLASTTTDFWRMVQQESSHLLVML
TTVMEAGRQKCHQYWPVTGEELQLAEGFSVRCLSETPDETGSFVFREFVLKDKHEQRHIH
HMQYLAWPDHCVPSDPILFLEFTERVRSARSRTLLQEIEESLKQVRLMDADADADENGGL
MRERKCAASNGATPEDETPVSTSVHQCISAANPPVIVHCSAGIGRTGVLILMDTALALME
AREPVYPLDIVRTMRDQRACMVQNVSQYRFVCECICAAYMKMSRNSEAIKDDED
Download sequence
Identical sequences 7217.FBpp0128095 FBpp0128095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]