SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070026 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070026
Domain Number 1 Region: 201-275
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-18
Family PHD domain 0.0043
Further Details:      
 
Weak hits

Sequence:  FBpp0070026
Domain Number - Region: 120-186
Classification Level Classification E-value
Superfamily RING/U-box 0.0184
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070026   Gene: FBgn0031091   Transcript: FBtr0070027
Sequence length 520
Comment type=protein; loc=X:complement(20054951..20055908,20055973..20056475,20056568..20056669); ID=FBpp0070026; name=CG9576-PA; parent=FBgn0031091,FBtr0070027; dbxref=GB_protein:AAF45372.2,FlyBase:FBpp0070026,FlyBase_Annotation_IDs:CG9576-PA,REFSEQ:NP_608374,GB_protein:AAF45372,FlyMine:FBpp0070026,modMine:FBpp0070026; MD5=54bd19545092d04988e5c9e5b3dc16e8; length=520; release=r5.30; species=Dmel;
Sequence
MVQICVLCLSGERDELIFGTVHVEGNMMVHRNCLYLSSNLIQRGEKKLSIMNFLKEDIEA
EVNRCRLLKCCYCRRLGANIWCCKSGCRRTFHTKCGVDNLAQNQFCDTYNSFCHQHVLVP
RNRPVFKNDEECLLCAEDVVAKGERFSVVTCLYAPCCRNGWFHRRCLQRYANSSGYFFKC
PLCNNTDVFRRVAYMGIAVLDQDASWETEPDAFAGQYRRDVNCTAALCVAVSGRADTSAM
LLYCTSCGANPSHYLCTLKTLQNYVCKVCSAVSPEAVPVAESDSDDAGSMDDSAEAPRPG
HLNGDQIQEKLSPSHWDDFGSSDDDAVFQRAFDTKVQSRVVTLSDDQPSTSAGARALADR
GTRTFESQGTQTTFLSSVVTSFRSATATATSSTSTSTSTSASTLDNQENTEPSTSNGRRP
WRPRYVSPPRHVSDSDDDSDEYDSDEYESKRRQLTPTAAAPSNGRRLLGSISPEPSTPAP
RVLRRRTLANRPSSLANMDISCVANRTRHRLSNHMASRKD
Download sequence
Identical sequences Q9W5W9
FBpp0070026 FBpp0070026 FBpp0305726 FBpp0305727 NP_001259740.1.81976 NP_001259741.1.81976 NP_608374.1.81976 7227.FBpp0070026 FBpp0070026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]