SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070184 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070184
Domain Number 1 Region: 332-553
Classification Level Classification E-value
Superfamily Kelch motif 3.2e-45
Family Kelch motif 0.0028
Further Details:      
 
Domain Number 2 Region: 553-605,638-704
Classification Level Classification E-value
Superfamily POZ domain 1.16e-18
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 797-887
Classification Level Classification E-value
Superfamily POZ domain 2.36e-18
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070184   Gene: FBgn0040344   Transcript: FBtr0070191
Sequence length 975
Comment type=protein; loc=X:complement(818247..818651,818772..818950,819006..819181,819251..820666,820729..821480); ID=FBpp0070184; name=CG3711-PA; parent=FBgn0040344,FBtr0070191; dbxref=FlyBase_Annotation_IDs:CG3711-PA,GB_protein:AAF45563.1,FlyBase:FBpp0070184,REFSEQ:NP_569869,GB_protein:AAF45563,FlyMine:FBpp0070184,modMine:FBpp0070184; MD5=db4c9fd186f6e876e624c1e01cbbdd5e; length=975; release=r5.30; species=Dmel;
Sequence
MLKSISGGVGVASTERGGGGGGCGGGGAGGSASGSRSTSGSGRASCGLGSSSISSGLSAV
CGFVTGASGGGGFERDRDRDRGLANISGGSTPAGILYCPACMAAANQQSPSQNSSPHHES
FFLRSSFKSSKRNKARKSASTAGCLDAQHIRANLRMSMSSSMRSSRGNGGGGAASSSHPP
GSSCSSGPGGSGCSMAYDAASNASSGSGSGSGKATSPGSYSCNALNVDFTSYTATHQWTR
MLECAEFVGAKRSKHTVVAYKDAMFVFGGDNGKNMLNDLIRFGVKDKSWGRACATGTPPA
PRYHHSAVVAGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGRQPVPRS
AHGAAVYDNKMWIYAGYDGNARLNDMWTLNLTGENQWEEVDQLGDRPPTCCNFPVAVARD
AMYVFSGQSGLQITNSLFEFHFKTRTWRRISNEPVLRGATSAPPSRRYGHTMVHHDRFLY
VFGGSADSTLPNDLHCYDLDSQVWSVIQPEQNSDVPSGRVFHASAVICDAMYIFGGTVDN
SVRRGDTYRFQFSSYPKCTLRDDFGKFFQDKQFCDIQFIVGAEEIRILAHIAFVAARSKY
LRNKILAAREARQQQMEKVYGVGQVDALALNAGAGGDRGPMLEVRLANASPEAFEIILNY
IYTDRIDLKDTYSKNIIILITDIYQLAGLFTMPRLAHGCIQYLDYKINKLNVLEALYNAD
KSNIKIIKDHCMQFIIKEENFTDVVMSSEFSDLDKPLLVEIIRKRLYPSKLVIDTSYEGN
IGTTLEIDLCAFLESTGKDFCDISLVLEDHVIPAHKSVLSSRCTYFQGMFRSFMPPDNTV
NIQIGEISPSLEAFHSLLRYIYYGETKMPPQDALYLFQAPCFYGLANNRLHAFCKYSLEH
NITFENVLQTLEASDITKIYDIKEYALKLIVKDFAKVARLPKIAGLSRELLLEIIRAVAD
SHGEFLTRININTDI
Download sequence
Identical sequences Q9V410
FBpp0070184 FBpp0070184 FBpp0070184 FBpp0303734 NP_569869.2.81976 7227.FBpp0070184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]