SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070249 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070249
Domain Number 1 Region: 11-131
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-26
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 2 Region: 148-217
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070249   Gene: FBgn0025381   Transcript: FBtr0070259
Sequence length 316
Comment type=protein; loc=X:1373272..1374222; ID=FBpp0070249; name=CG14782-PA; parent=FBgn0025381,FBtr0070259; dbxref=FlyBase:FBpp0070249,FlyBase_Annotation_IDs:CG14782-PA,GB_protein:AAF45637.1,REFSEQ:NP_569923,GB_protein:AAF45637,FlyMine:FBpp0070249,modMine:FBpp0070249; MD5=a071e30e8e3b599aef55f16a4493432c; length=316; release=r5.30; species=Dmel;
Sequence
MVDRLVNSEANTRRIASVENCFGSSGVPLAMQGRVLVGEGVLTKMCRKRPKSRQFFLFND
ILVYGNIVIGKKKYNKQHIMPLEEVSLESIADNQTYRNGWYIRTTTKSFVVFAATSTEKQ
EWMAHINKCVEDLLRKSGKKPVENHAAVWVPDTDASVCMHCKKTQFTFIQRRHHCRNCGA
VVCAGCSAKKFLLPQQSTKALRVCDACYERLKHVPSSLGSGEDSAAATGAASGNKLNTTA
GDSSNDEDSDEETASPGGESHDEPRFYGDNSVLSAVEDSSTITSPSSATTGSLEAPQVTP
SVQSSPAAVATTGSHC
Download sequence
Identical sequences O76902
FBpp0070249 7227.FBpp0070249 FBpp0070249 NP_001284784.1.81976 NP_569923.2.81976 FBpp0070249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]