SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070439 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070439
Domain Number 1 Region: 3499-3706
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-36
Family Laminin G-like module 0.00046
Further Details:      
 
Domain Number 2 Region: 4008-4216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-28
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 3 Region: 3753-3956
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-27
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 2736-2822
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 2642-2725
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000934
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 2827-2911
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family I set domains 0.05
Further Details:      
 
Domain Number 7 Region: 1223-1305
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000537
Family I set domains 0.061
Further Details:      
 
Domain Number 8 Region: 2544-2619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000566
Family I set domains 0.043
Further Details:      
 
Domain Number 9 Region: 2352-2445
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000102
Family I set domains 0.035
Further Details:      
 
Domain Number 10 Region: 1187-1225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000628
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 2447-2537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000637
Family I set domains 0.014
Further Details:      
 
Domain Number 12 Region: 3037-3144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000141
Family I set domains 0.032
Further Details:      
 
Domain Number 13 Region: 3357-3437
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000172
Family I set domains 0.035
Further Details:      
 
Domain Number 14 Region: 1144-1179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 15 Region: 956-996
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 523-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 17 Region: 3433-3514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000877
Family I set domains 0.022
Further Details:      
 
Domain Number 18 Region: 3124-3213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000168
Family I set domains 0.035
Further Details:      
 
Domain Number 19 Region: 238-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 20 Region: 326-368
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 1021-1060
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 22 Region: 3238-3279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 877-914
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 24 Region: 1101-1139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 752-788
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 26 Region: 917-951
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 27 Region: 655-691
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000851
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 28 Region: 3694-3736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.013
Further Details:      
 
Domain Number 29 Region: 573-613
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 30 Region: 111-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 473-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000034
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 32 Region: 71-106
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 33 Region: 154-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 34 Region: 841-875
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000995
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 35 Region: 1951-2000
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000113
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 36 Region: 694-731
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000114
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 37 Region: 802-838
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 38 Region: 1608-1656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000272
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 39 Region: 438-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 40 Region: 619-654
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000877
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 1914-1953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000905
Family EGF-type module 0.076
Further Details:      
 
Domain Number 42 Region: 2951-3017
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000259
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  FBpp0070439
Domain Number - Region: 194-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000393
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 2261-2298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 1544-1572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 1668-1710
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0181
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 2033-2070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070439   Gene: FBgn0261451   Transcript: FBtr0091964
Sequence length 4228
Comment type=protein; loc=X:complement(2365185..2365227,2366985..2367132,2367208..2367624,2367693..2368393,2368463..2369388,2369449..2369721,2369857..2370062,2371510..2371842,2374767..2374941,2375103..2375352,2375450..2375909,2376030..2376424,2376492..2376669,2377157..2377419,2377519..2378122,2378366..2378546,2378650..2378792,2380960..2382046,2382114..2384350,2384489..2384875,2386379..2386453,2386688..2386918,2387021..2387248,2387584..2387709,2388437..2388670,2389074..2389271,2389645..2389761,2389981..2390066,2390494..2390626,2390809..2390958,2391351..2391521,2392055..2392148,2392516..2392664,2393244..2393711,2394270..2394395,2394596..2394709,2394804..2394935,2395152..2395274,2395660..2395770,2399163..2399376); ID=FBpp0070439; name=trol-PE; parent=FBgn0261451,FBtr0091964; dbxref=FlyBase:FBpp0070439,FlyBase_Annotation_IDs:CG33950-PE,GB_protein:AAN09078.1,REFSEQ:NP_001027035,GB_protein:AAN09078,FlyMine:FBpp0070439,modMine:FBpp0070439; MD5=6f2a6675c654b8746af576a063314d49; length=4228; release=r5.30; species=Dmel;
Sequence
MTSETPDPLTPSPQPPLANDSLNNALHQGVKAQRGWMRMWNVCIFMSFVLSCHFDVDCWQ
CLHSRKSRAKNKCQANEFRCNNGDCIDARKRCNNVSDCSEGEDENEECPAACSGMEYQCR
DGTRCISVSQQCDGHSDCSDGDDEEHCDGIVPKLRYTCPKGKFTCRDLSCISIVHRCDGR
ADCPNDRSDEEGCPCLYDKWQCDDGTCIAKELLCNGNIDCPEDISDERYCEGGYDSEECR
FDEFHCGTGECIPMRQVCDNIYDCNDYSDEVNCVEGEEEDRVGIPIGHQPWRPASKHDDW
LHEMDTSEYQVYQPSNVYEKANSQNPCASNQFRCTTSNVCIPLHLRCDGFYHCNDMSDEK
SCEQYQRHTTTRRPLTLATPTSRITTQGPGLLERRNTTTATEASRWPWATKTTTIATTTS
NPITTVGVANSPPQTCLENIEFACHNRDCISIESVCDGIPDCGRNEDEDDALCKCSGDKY
KCQRGGGCIPKSQVCDGKPQCHDRSDESACHLHGRLNKTRLGVKCLESQYQCGDGSCISG
YKRCNGIHDCADASDEYNCIYDYEDTYDTDPNNNPLNECDILEFECDYSQCLPLEKKCDG
YADCEDMSDELECQSYTDHCLESEFECDSYCLPRDQLCNGIPNCQDGSDERNCTFCREDA
YLCNTGECVADNQRCNGIADCADGSDERHCARIYCPPNKLACNGTCVSRRIKCDGIRDCL
DGYDEMYCPETNNHYPTQNVNVIRPKLGPNPIPKSCRPHEWQCANLECIDSSLQCNEIKD
CSDGSDEELSVCFGTATTRLKPSDCSPEQFYCDESCYNRSVRCNGHVDCSDGSDEVGCSL
PCPQHQCPSGRCYTESERCDRHRHCEDGSDEANCTAILCKDNEFLCFDRQFCINATQQCD
GYYDCRDFSDEQNCIGCYANQFRCNNGDCVSGSAPCNGYSECSDHSDELNCGGTQECLPN
QFRCNSGQCVSSSVRCNGRTDCQDSSDEQNCGHRHTEVSQGLETTGVFTTSTTSTTAMTP
LRIICPPTSFKCENGPCISLGLKCNGRVDCPYDGSDEADCGQISNDIDPADSNDRRPNQL
NLKTYPDSQIIKENNDVGSRPESACTEYQATCMNGECIDKSSICDGNPDCSDASDEQSCS
LGLKCQPNQFMCSNSKCVDRTWRCDGENDCGDNSDETSCDPEPSGAPCRYNEFQCRSGHC
IPKSFQCDNVPDCTDGTDEVGCMAPLPIRPPPQSVSLLEYEVLELTCVATGTPTPTIVWR
LNWGHVPDKCESKSYGGTGTLRCPDMRPQDSGAYSCEIINTRGTHFVNPDTIVTVRPVRT
DVCEAGFFNMLARKAEECVQCFCFGVAKACDSANLFTYAIHPPILSHRVVSVELSPLRQI
VINEAAPGQDLLTLLHGVQFRATNVHFSGRETPYLALPADYMGNQLKSYGGNLRYEVNYR
GSGRPVNGPDVIITGNRFTLTYRVRTQPGQNNRVSIPFVPGGWQKPDGRKASREEIMMIL
ANVDNILIRLGYLDSTAREVDLINIALDSAGTADKGLGSASLVEKCQCPPGYVGDSCESC
ASGYVRQPGGPWLGHCVPFIPDSCPSGTYGDPRRGVPCKECPCPLTGSNNFASGCQQSPD
GDVVCRCNEGYTGRRCEQCAAGYQGNPLAAGGICRRIPDTSCNVDGTYSVHSNGTCQCKD
SVIGEQCDTCKSKSFHLNSFTYTGCIECFCSGVGLDCDSSTWYRDQVTSTFGRSRVDHGF
VLVTNYMQPTPDTVPVSMAAEPNALSFIGSADQSGNTLYWSLPAAFLGNKLSSYGGKLTY
TLSYSPLPNGIMSRNSAPDVVIKSGEDLRLIHYRKSQVVPSVANTYSVEIKESAWQRGDE
VVANREHVLMALSDITAIYIKATYTTSTKEASLRQVTLDVATPTNLGTPRAVEVEQCRCP
EGYLGLSCEQCAPGYARDPEGGIYLGLCRPCECNGHSKYCNSDTGDCEECSDNTEGPSCE
RCAAGYVGDATRGTIYDCQPDEGYPIPSPPAPGNQTLECTAYCQIEGIYDCRGNECLCKR
NVIGDQCDQCRPGTYGLSAQNQDGCKECYCSGLASQCRSAALYRQLIPVDFILNAPLITD
ESGAVQDTENLIPDISRNMYTYTHTSYLPKYWSLRGSVLGNQLFSYGGRLSYSLIVESYG
NYERGHDIVLIGNGLKLIWSRPDGNENQEEYNVRLHEDEQWTRQDRESARPASRSDFMTV
LSDLQHILIRATPRVPTQSTSIGNVILESAVTTRTPGATHASDIELCQCPSGYVGTSCES
CAPLHYRDASGSCSLCPCDVSNTESCDLVSGGYVECRCKARWKGDRCREIDTNDPTDIGT
EDPVLTQIIVSIQKPEITIVPVGGSMTLSCSGRMRWSNSPVIVNWYKENSRLPENVEVQG
GNLYLYDLQVSDSGVYICQAVNNETASVFKDTVSITITKKDQLSPAEIVNLPSHVTFEEY
VNNEIICEVLGNPAPRVTWARVDGHADAQSTRTYDNRLIFDSPRKSDEGRYRCQAENDQN
RDEKYVIVYVQSNPPQPPPQQDRLYITPEEINGLAGESFQLNCQFTSVASLRYDWSHNGR
SLSSSPARNVEIRGNTLEVRDASESDSGVYTCVAYDVRTRRNFTESARVNIDRREEQPFG
NKPIIESLEQNILIIQGEDYSITCEASGSPYPSIKWAKVHDFMPENVHISGNVLTIYGAR
FENRGVYSCVAENDHGSDLSSTSIDIEPRERPSVKIVSAPLQTFSVGAPASLYCTVEGIP
DPTVEWVRVDGQPLSPRHKIQSPGYMVIDDIQLEDSGDYECRAKNIVGEATGVATITVQE
PTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWVNEMALKRDLYSPPSNTAILKIY
RVTKADAGIYTCHGKNEAGSDEAHVRVEVQERRGDIGGVDDDSDRDPINYNPPQQQNPGI
HQPGSNQLLATDIGDNVTLTCDMFQPLNTRWERVDGAPLPRNAYTIKNRLEIVRVEQQNL
GQYRCNGIGRDGNVKTYFVKELVLMPLPRIRFYPNIPLTVEAGQNLDVHCQVENVRPEDV
HWSTDNNRPLPSSVRIVGSVLRFVSITQAAAGEYRCSAFNQYGNRSQIARVAVKKPADFH
QVPQSQLQRHREGENIQLQCTVTDQYGVRAQDNVEFNWFRDDRRPLPNNARTDSQILVLT
NLRPEDAGRYICNSYDVDRGQQLPEVSIDLQVLNFKSSKLSSAKPIISGPATTRAPAISY
VCQPNDFKCVSHPHTCVRANMVCDGIYDCTDHSDEFNCIAGKGSGKSESNSGSGSFKRWK
KSPEQGRRSLAKAVKNRKLRKRSFAATPPPNSPIYLPPQLPAKSRDYSLKLDDQSSNLRA
GESTDVECYSSDDTYTDVVWERSDGAPLSNNVRQVGNRLVISNVSPSDAGNYVCKCKTDE
GDLYTTSYKLEVEDQPHELKSSKIVYAKVGANADLQCGADESRQPTYRWSRQYGQLQAGR
SLMNEKLSLDSVQANDAGTYICTAQYADGETADFPNILVVTGAIPQFRQEPRSYMSFPTL
PNSSFKFNFELTFRPENGDGLLLFNGQTRGSGDYIALSLKDRYAEFRFDFGGKPMLVRAE
EPLALNEWHTVRVSRFKRDGYIQVDEQHPVAFPTLQQIPQLDLIEDLYIGGVPNWELLPA
DAVSQQVGFVGCISRLTLQGRTVELIREAKYKEGITDCRPCAQGPCQNKGVCLESQTEQA
YTCICQPGWTGRDCAIEGTQCTPGVCGAGRCENTENDMECLCPLNRSGDRCQYNEILNEH
SLNFKGNSFAAYGTPKVTKVNITLSVRPASLEDSVILYTAESTLPSGDYLALVLRGGHAE
LLINTAARLDPVVVRSAEPLPLNRWTRIEIRRRLGEGILRVGDGPERKAKAPGSDRILSL
KTHLYVGGYDRSTVKVNRDVNITKGFDGCISRLYNFQKPVNLLADIKDAANIQSCGETNM
IGGDEDSDNEPPVPPPTPDVHENELQPYAMAPCASDPCENGGSCSEQEDVAVCSCPFGFS
GKHCQEHLQLGFNASFRGDGYVELNRSHFQPALEQSYTSMGIVFTTNKPNGLLFWWGQEA
GEEYTGQDFIAAAVVDGYVEYSMRLDGEEAVIRNSDIRVDNGERHIVIAKRDENTAILEV
DRMLHSGETRPTSKKSMKLPGNVFVGGAPDLEVFTGFRYKHNLNGCIVVVEGETVGQINL
SSAAVNGVNANVCPANDDPLGGTEPPVV
Download sequence
Identical sequences FBpp0070439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]