The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0070453 |
Domain Number 1 |
Region: 53-356 |
Classification Level |
Classification |
E-value |
Superfamily |
Protein kinase-like (PK-like) |
7.06e-88 |
Family |
Protein kinases, catalytic subunit |
0.000000000201 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Biological Process |
IC (bits) |
H-Score |
Molecular Function |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0070453 Gene: FBgn0003371 Transcript: FBtr0070470 |
Sequence length |
514 |
Comment |
type=protein; loc=X:join(2536042..2536126,2563946..2564136,2564207..2564290,2565154..2565264,2565341..2565578,2565662..2565855,2566947..2567136,2567208..2567651,2568630..2568637); ID=FBpp0070453; name=sgg-PC; parent=FBgn0003371,FBtr0070470; dbxref=FlyBase:FBpp0070453,FlyBase_Annotation_IDs:CG2621-PC,GB_protein:AAN09084.1,REFSEQ:NP_599105,GB_protein:AAN09084; MD5=08f524d0ec155f42d5198b91f74bd602; length=514; release=r5.30; species=Dmel; |
Sequence |
MSGRPRTSSFAEGNKQSPSLVLGGVKTCSRDGSKITTVVATPGQGTDRVQEVSYTDTKVI
GNGSFGVVFQAKLCDTGELVAIKKVLQDRRFKNRELQIMRKLEHCNIVKLLYFFYSSGEK
RDEVFLNLVLEYIPETVYKVARQYAKTKQTIPINFIRLYMYQLFRSLAYIHSLGICHRDI
KPQNLLLDPETAVLKLCDFGSAKQLLHGEPNVSYICSRYYRAPELIFGAINYTTKIDVWS
AGCVLAELLLGQPIFPGDSGVDQLVEVIKVLGTPTREQIREMNPNYTEFKFPQIKSHPWQ
KVFRIRTPTEAINLVSLLLEYTPSARITPLKACAHPFFDELRMEGNHTLPNGRDMPPLFN
FTEHELSIQPSLVPQLLPKHLQNASGPGGNRPSAGGAASIAASGSTSVSSTGSGASVEGS
AQPQSQGTAAAAGSGSGGATAGTGGASAGGPGSGNNSSSGGASGAPSAVAAGGANAAVAG
GAGGGGGAGAATAAATATGAIGATNAGGANVTDS
|
Download sequence |
|
Identical sequences |
A4V3W2 P18431
FBpp0070449 FBpp0070451 FBpp0070452 FBpp0070453 FBpp0089158 FBpp0089162 NP_476715.1.81976 NP_599105.1.81976 NP_726822.1.81976 NP_726823.1.81976 NP_996337.1.81976 NP_996338.1.81976 FBpp0070449 FBpp0070451 FBpp0070452 FBpp0070453 FBpp0089158 FBpp0089162 |