SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070646 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070646
Domain Number 1 Region: 29-251
Classification Level Classification E-value
Superfamily alpha/beta knot 2.35e-79
Family EMG1/NEP1-like 0.00000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070646   Gene: FBgn0029714   Transcript: FBtr0070678
Sequence length 252
Comment type=protein; loc=X:join(4446109..4446276,4446341..4446931); ID=FBpp0070646; name=CG3527-PA; parent=FBgn0029714,FBtr0070678; dbxref=FlyBase:FBpp0070646,FlyBase_Annotation_IDs:CG3527-PA,GB_protein:AAF45956.2,REFSEQ:NP_572170,GB_protein:AAF45956,FlyMine:FBpp0070646,modMine:FBpp0070646; MD5=5e013bc39e507b8af141427156bce121; length=252; release=r5.30; species=Dmel;
Sequence
MGGQGKAINRKRKFVGRKADDPEFDLDKKQFKVLHLNATEKRLIIVLEGAQLETVKVHNT
FELLNCDDHAGIMRKNQRDPGSCRPDITHQCLLMLFDSPLNRAGLLQVFVRTEHNVLIEI
NPQTRIPRTFKRFAGLMVQLLHKFQIRANDSSRRLMSVIKNPITDHVPVGCKKYAMSFSG
KLLPNCRDLVPHGDETSASYDEPVVIVIGAFAHGVLKTDYTEELFSISNYPLSAAIACSK
ICSAFEEVWGVV
Download sequence
Identical sequences Q9W4J5
FBpp0070646 FBpp0070646 NP_572170.1.81976 FBpp0070646 7227.FBpp0070646 FR300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]