SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070719 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070719
Domain Number - Region: 191-273
Classification Level Classification E-value
Superfamily Translin 0.0667
Family Translin 0.043
Further Details:      
 
Domain Number - Region: 260-354
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070719   Gene: FBgn0029755   Transcript: FBtr0070751
Sequence length 428
Comment type=protein; loc=X:5211537..5212823; ID=FBpp0070719; name=Sas10-PA; parent=FBgn0029755,FBtr0070751; dbxref=FlyBase:FBpp0070719,FlyBase_Annotation_IDs:CG4202-PA,GB_protein:AAG22407.2,REFSEQ:NP_572215,GB_protein:AAG22407,FlyMine:FBpp0070719,modMine:FBpp0070719; MD5=f632f5864190812b838f22d85e973316; length=428; release=r5.30; species=Dmel;
Sequence
MDSDGDDYVMSGSDQEYDDEEREILEDLRKQRKKPHDPVQEVLGFSDDDDDDDDDDEEEQ
QDVAELMRDSDIEGAEDDDRDLPNTMDWGSKRSTYYNTDFVDQDYSSYNAQEEEQARAEE
EEAKKIQLRLAKRMSEADFQLDNVEAAPAGSSDDNELSHITKVTSDLAGLSERERRQLMH
SESPEFIILTQDFQQHLDEVKNLLKPVLNYVRKHDVPMVPALQYAGLCHTVLTTYCSNVA
FYLLLKARRIDVKAHPVIRRLVQLKDLIEELKPRYEEYIRPQLEALLERIEDGDAFTVLD
VAQRKAKLQILNKYNDGQQASVSSDDDDNDDDDDAESKEKDLQEEAGEEEEEEDARRGIT
YQMAKNKGLTPHRKKELRNPRVKHRGKYRKALIRRKGAVRTVRKELQRYGGELSGIKAGV
TKSVKFRT
Download sequence
Identical sequences Q9I7W5
FBpp0070719 7227.FBpp0070719 FBpp0070719 FBpp0070719 NP_572215.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]