SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070786 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0070786
Domain Number - Region: 111-203,290-404,437-467
Classification Level Classification E-value
Superfamily ARM repeat 0.0432
Family Plakophilin 1 helical region 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070786   Gene: FBgn0029820   Transcript: FBtr0070821
Sequence length 494
Comment type=protein; loc=X:join(5775086..5775354,5775419..5775903,5775968..5776268,5776330..5776496,5776560..5776822); ID=FBpp0070786; name=CG16721-PA; parent=FBgn0029820,FBtr0070821; dbxref=FlyBase:FBpp0070786,FlyBase_Annotation_IDs:CG16721-PA,GB_protein:AAF46097.1,REFSEQ:NP_572275,GB_protein:AAF46097,FlyMine:FBpp0070786,modMine:FBpp0070786; MD5=b7142401bb708b48f39e3322b185e7f5; length=494; release=r5.30; species=Dmel;
Sequence
MDAQENRSEQSGQSGDHEEHEERRIRTDSESSVESMTRFVLPSLDGTPPKIVTLDEVSSM
FKNLRNMELAHEIALNPDFKLQKYEPPSDSLEGAIKKMVHKAFWDLLRVQLDRQPPSYDQ
AIRLLAEIKECFPQLLSPNNERALAHINEVLDDSVIRQQAERGTLDFRAYANFVINILSR
SCSPARDEAVAALRKIDDVVDTFRCILELMTLMKLDMANFMLRLARTEIAANSVQYEKEK
FSKYLREFHGNVGFPATEDWLQRHRSGSSDDETIYNAYMQLIDYPADKEFPELLRIDKER
FAGLSWRAQRLILCASLISVAQGMPIISQRRENRIKLAQQLDIIVQDIKNQDQVASTIES
CYEQIRSFVNKALEQENLPALSDADQAALKNQVLKLANKTSPVPSLMAKRLDGYVRVTLR
SNGSIPPPPSGFADYQEELVAFIASFRRLVSYNHAVFGEHFHQILNKTLPGEETEATTST
ASGINPGQAQTAKP
Download sequence
Identical sequences Q9W461
7227.FBpp0070786 FBpp0070786 NP_001284913.1.81976 NP_001284914.1.81976 NP_572275.1.81976 FBpp0070786 FBpp0070786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]