SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0070883 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070883
Domain Number 1 Region: 3-296
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 6.21e-112
Family Protein serine/threonine phosphatase 0.0000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070883   Gene: FBgn0003139   Transcript: FBtr0070921
Sequence length 303
Comment type=protein; loc=X:complement(6265762..6266220,6266309..6266596,6266685..6266849); ID=FBpp0070883; name=PpV-PA; parent=FBgn0003139,FBtr0070921; dbxref=FlyBase:FBpp0070883,FlyBase_Annotation_IDs:CG12217-PA,GB_protein:AAF46163.1,REFSEQ:NP_511061,GB_protein:AAF46163,FlyMine:FBpp0070883,modMine:FBpp0070883; MD5=b5c7cb090678c354b5bebc0e459d2d26; length=303; release=r5.30; species=Dmel;
Sequence
MGDVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLE
QLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKV
YGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRN
GEIPYKGAFCDLVWSDPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNE
GIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQTKIFLAVPDAERVIPKQNTTP
YFL
Download sequence
Identical sequences M9PGI3 Q27884
7227.FBpp0070883 NP_001259272.1.81976 NP_001259273.1.81976 NP_001259274.1.81976 NP_511061.1.81976 FBpp0070883 FBpp0303847 FBpp0303848 FBpp0303849 FBpp0070883 7290716___KOG0373 FBpp0070883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]