The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
Sequence: |
FBpp0070913 |
Domain Number 1 |
Region: 24-247 |
Classification Level |
Classification |
E-value |
Superfamily |
Nucleic acid-binding proteins |
8.57e-56 |
Family |
DNA replication initiator (cdc21/cdc54) N-terminal domain |
0.00024 |
Further Details: |
|
|
Domain Number 2 |
Region: 347-657 |
Classification Level |
Classification |
E-value |
Superfamily |
P-loop containing nucleoside triphosphate hydrolases |
4.49e-39 |
Family |
Extended AAA-ATPase domain |
0.055 |
Further Details: |
|
|
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
Molecular Function |
IC (bits) |
H-Score |
Cellular Component |
IC (bits) |
H-Score |
Biological Process |
IC (bits) |
H-Score |
External link(s) |
Protein: FBpp0070913 Gene: FBgn0025815 Transcript: FBtr0070952 |
Sequence length |
817 |
Comment |
type=protein; loc=X:6568539..6570992; ID=FBpp0070913; name=Mcm6-PA; parent=FBgn0025815,FBtr0070952; dbxref=FlyBase:FBpp0070913,FlyBase_Annotation_IDs:CG4039-PA,GB_protein:AAF46184.1,REFSEQ:NP_511065,GB_protein:AAF46184,FlyMine:FBpp0070913,modMine:FBpp0070913; MD5=a28e8fa20c8db71d3647f444ec1b0246; length=817; release=r5.30; species=Dmel; |
Sequence |
MDVADAQVGQLRVKDEVGIRAQKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFE
DVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKDCYVAFTEVPTRHKVRDL
TTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCS
NRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTG
TLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTA
RFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGI
LLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAG
LTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAG
VRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAI
ARKIVDLHSNIEESVERAYTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGT
SGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRVEQPDIHLDD
DEGLDMDDGIQHDIDMENNGAAANVDENNGMDTSASGAVQKKKFTLSFEDYKNLSTMLVL
HMRAEEARCEVEGNDTGIKRSNVVTWYLEQVADQIESEDELISRKNLIEKLIDRLIYHDQ
VIIPLKTSTLKPRIQVQKDFVEEDDPLLVVHPNYVVE
|
Download sequence |
 |
Identical sequences |
C6SUY3 Q9V461
FR592 NP_511065.1.81976 FBpp0070913 7227.FBpp0070913 FBpp0070913 FBpp0070913 |