SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071085 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071085
Domain Number 1 Region: 6-90
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000377
Family Single strand DNA-binding domain, SSB 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071085   Gene: FBgn0029977   Transcript: FBtr0071133
Sequence length 486
Comment type=protein; loc=X:complement(7812550..7812937,7813041..7813197,7813249..7814164); ID=FBpp0071085; name=hdm-PA; parent=FBgn0029977,FBtr0071133; dbxref=FlyBase:FBpp0071085,FlyBase_Annotation_IDs:CG15329-PA,GB_protein:AAF46293.1,REFSEQ:NP_572422,GB_protein:AAF46293,FlyMine:FBpp0071085,modMine:FBpp0071085; MD5=c2382bcdc837c74f09c03295242f5305; length=486; release=r5.30; species=Dmel;
Sequence
MARRIKFQRLAEMRPTMTRFSTVALIVSKSSPNIFYDKMSGTERGVLSLTIRDSPNHLTN
CKCWGQRDCVDEYAAMLQIGHVVDIVGAKVMSIPFAAPGEQRYQPQATVSCALVVNEGSG
YVVRHDNDDFGQITILQQLLHQPIRPLGAVLKLADVRSGLGFPDKIITTNVNLLVVVAAV
RPVRQIKRKLQGPLSEVQELLQCLEVIVIDASYPEGMLLSVWQPDWIQRAQQWQPRRTVL
HLIDVRVSYSNFHRSLVLSHSNCTLICENPQAAGDDCRLLLAFAATVPLTTFSGCDQAEL
DNMPAVASIQAQMTVRQIYSRAEGELQDPSIHQFTAVLYGMVTKFDLDGLTSHVNRKCIA
CQQHIPRNLQDCASDACQQYFSLDNDEPRSISYFNINIHLSDQTGTLVEARLAGHPAERI
LGLRAEDFERLAEREKSELKWRFLLKYFEVRLMIKKPVGVRNHLVIVVVDMQAIPLEKLV
ANMVVF
Download sequence
Identical sequences Q9W3M9
FBpp0071085 NP_572422.1.81976 7227.FBpp0071085 FBpp0071085 FBpp0071085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]