SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071251 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071251
Domain Number 1 Region: 323-519
Classification Level Classification E-value
Superfamily Kelch motif 9.81e-56
Family Kelch motif 0.000028
Further Details:      
 
Domain Number 2 Region: 52-172
Classification Level Classification E-value
Superfamily POZ domain 3.14e-31
Family BTB/POZ domain 0.0014
Further Details:      
 
Domain Number 3 Region: 529-611
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-21
Family Kelch motif 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071251   Gene: FBgn0030114   Transcript: FBtr0071316
Sequence length 654
Comment type=protein; loc=X:join(9144803..9145062,9146561..9147604,9147684..9147891,9147950..9148072,9148146..9148382,9149661..9149753); ID=FBpp0071251; name=CG17754-PA; parent=FBgn0030114,FBtr0071316; dbxref=FlyBase:FBpp0071251,FlyBase_Annotation_IDs:CG17754-PA,GB_protein:AAN09250.2,REFSEQ:NP_572549,GB_protein:AAN09250,FlyMine:FBpp0071251,modMine:FBpp0071251; MD5=eb1424a3015d776faea95a6b0721e33d; length=654; release=r5.30; species=Dmel;
Sequence
MSAVNQKESPSRDSTASTSGHISMLADNTLESLSRDYSLGSLNSAGSQDEFFRCRDHADN
ILKRMQLYVDSQQLCDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTL
GEVHGDALHLLVQYCYTGFIEMREDTVETLLATACLLQLNAVVTACCNFLARQLHPSNCL
GFAFFAEQQSCTTLLRLAQAYTCQYFMQVCQNQEFFQLNADQLGKLLSSDDLNVPSEQDV
FHSLMSWVRHDSAAREQHIPELLALVRLPLLQPAFIMDHVENVCNANECQQLVMEAFKWH
LMPERRSRIATERTTPRKSTVGRLLAVGGMDAHKGAISIESYCPRLDKWTPWKHMTGRRL
QFGAAVMEDKLILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVLEGPLYA
VGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHRSI
ECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPAT
DTWTLICSLALGRDAIGCALLGDRLIVVGGYDGNHALKSVEEYDPVRNGWNELAPMAFAR
AGACVVAIPNVIPPAAQQPPPSATKKKKWKPVRLDPICYNRRPRCVEFVDYYNM
Download sequence
Identical sequences Q7K0L2
NP_572549.2.81976 NP_727331.1.81976 FBpp0071249 FBpp0071251 FBpp0071249 FBpp0071251 7227.FBpp0071249 FBpp0071249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]