SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071301 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071301
Domain Number 1 Region: 205-557
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.12e-114
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000279
Further Details:      
 
Domain Number 2 Region: 52-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.08e-36
Family Anticodon-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071301   Gene: FBgn0027084   Transcript: FBtr0071366
Sequence length 574
Comment type=protein; loc=X:complement(9500506..9500586,9500653..9501600,9501662..9502325,9502752..9502783); ID=FBpp0071301; name=Aats-lys-PA; parent=FBgn0027084,FBtr0071366; dbxref=FlyBase:FBpp0071301,FlyBase_Annotation_IDs:CG12141-PA,GB_protein:AAN09255.1,REFSEQ:NP_572573,GB_protein:AAN09255,FlyMine:FBpp0071301,modMine:FBpp0071301; MD5=7a217c9fe3bfd072cd4704963c945458; length=574; release=r5.30; species=Dmel;
Sequence
MAAASGELSKNELKRRLKAEQKAKEKAEKAAAAPAENTAGKKKSSAAEEEEISPNEYFKL
RSAAVQELKRSPATDPYPHKFHVSSSLEDFIAKYENSLKEGETLENVKLSVAGRVHAIRE
SGAKLIFYDLRGEGVKVQVMASAKSYKSEADFEIDTSKLRRGDIIGVVGHPGKTKKGELS
VMPSEIKLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNNNVREKFQIRAKIISYVRQF
LDRLGFLEIETPMMNMIAGGATAKPFVTHHNDLKMDLFMRIAPELYHKMLVVGGLDRVYE
IGRQFRNEGIDLTHNPEFTTCEFYMAYADYADIMDITEQLVSGMVKAIRGSYKVIYHPEG
PEGPEQELDFTPPFKRVSMIKTLEEKLQVKFPAADTFNSPETNQFLSQLCAKHQVECPAP
RTTARLLDKLVGEFIEEFCVNPTFICEHPQIMSPLAKYHRSIPGLTERFELFVAKKEICN
AYTELNDPVVQRERFEQQASDKAAGDDEAQLVDENFCTSLEYGLPPTGGFGMGIDRLAMF
LTDSNNIKEVLLFPAMKPEDANRTAAETAPTAQQ
Download sequence
Identical sequences Q8SXM8
NP_572573.1.81976 FBpp0071301 FBpp0071301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]