SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071302 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071302
Domain Number 1 Region: 238-590
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.31e-114
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000279
Further Details:      
 
Domain Number 2 Region: 85-230
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.2e-36
Family Anticodon-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071302   Gene: FBgn0027084   Transcript: FBtr0071367
Sequence length 607
Comment type=protein; loc=X:complement(9500506..9500586,9500653..9501600,9501662..9502325,9502455..9502585); ID=FBpp0071302; name=Aats-lys-PB; parent=FBgn0027084,FBtr0071367; dbxref=FlyBase:FBpp0071302,FlyBase_Annotation_IDs:CG12141-PB,GB_protein:AAF46510.2,REFSEQ:NP_727353,GB_protein:AAF46510,FlyMine:FBpp0071302,modMine:FBpp0071302; MD5=87f542d3f372ccea42f088d97ccaa685; length=607; release=r5.30; species=Dmel;
Sequence
MFARCALRTVQGSWPRCRYTGIQPLAAGFHVSAPQMEPSKQTKLELKRRLKAEQKAKEKA
EKAAAAPAENTAGKKKSSAAEEEEISPNEYFKLRSAAVQELKRSPATDPYPHKFHVSSSL
EDFIAKYENSLKEGETLENVKLSVAGRVHAIRESGAKLIFYDLRGEGVKVQVMASAKSYK
SEADFEIDTSKLRRGDIIGVVGHPGKTKKGELSVMPSEIKLLSPCLHMLPHLHFGLKDKE
TRYRQRYLDLILNNNVREKFQIRAKIISYVRQFLDRLGFLEIETPMMNMIAGGATAKPFV
THHNDLKMDLFMRIAPELYHKMLVVGGLDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAY
ADYADIMDITEQLVSGMVKAIRGSYKVIYHPEGPEGPEQELDFTPPFKRVSMIKTLEEKL
QVKFPAADTFNSPETNQFLSQLCAKHQVECPAPRTTARLLDKLVGEFIEEFCVNPTFICE
HPQIMSPLAKYHRSIPGLTERFELFVAKKEICNAYTELNDPVVQRERFEQQASDKAAGDD
EAQLVDENFCTSLEYGLPPTGGFGMGIDRLAMFLTDSNNIKEVLLFPAMKPEDANRTAAE
TAPTAQQ
Download sequence
Identical sequences Q9W327
7227.FBpp0071302 FBpp0071302 FBpp0292593 FBpp0071302 NP_001188571.1.81976 NP_727353.1.81976 FBpp0071302 FBpp0292593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]