SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071422 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071422
Domain Number 1 Region: 1772-1918
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000556
Further Details:      
 
Domain Number 2 Region: 1952-2047
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-16
Family PDZ domain 0.00016
Further Details:      
 
Domain Number 3 Region: 2052-2131
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000539
Family PDZ domain 0.00007
Further Details:      
 
Weak hits

Sequence:  FBpp0071422
Domain Number - Region: 756-858,1006-1051
Classification Level Classification E-value
Superfamily ARM repeat 0.00443
Family HEAT repeat 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071422   Gene: FBgn0052677   Transcript: FBtr0071493
Sequence length 2139
Comment type=protein; loc=X:join(10593306..10595154,10595837..10596034,10596487..10596866,10596932..10597495,10597597..10598128,10598187..10598708,10598790..10600046,10600985..10601115,10601850..10601855,10602100..10602867,10602929..10603069,10603121..10603192); ID=FBpp0071422; name=X11Lbeta-PA; parent=FBgn0052677,FBtr0071493; dbxref=FlyBase:FBpp0071422,FlyBase_Annotation_IDs:CG32677-PA,GB_protein:AAF46614.3,GB_protein:AAF46614,REFSEQ:NP_727440,GB_protein:AAF46614,FlyMine:FBpp0071422,modMine:FBpp0071422; MD5=427bed9ddf546b57add907c7ffbd137b; length=2139; release=r5.30; species=Dmel;
Sequence
MVSTTLTTLAAGQTTSSSNHHHHHHHSHQQQQQQQQQDQSQQQPHQQLPYQQRGYYALNG
SLELDCDTSNTNSSSSSNNIGYQQHQQQQQQQQQPPLILSQALLSPSPPLNDQISLLFPK
CRPKQQQQQQQQQQQQQQQQQQQLQPAQQHQQHVHPTDVNSSCNSNRSSSPTTAGAVGEP
LASVSVSPPPPKATPTSSTPSYYKSVNIITQSPPPHSASSHSSESLSSVTPRISTNPFLC
APLTPPTPPHHHHHHHHQQQHQQKQQQPKQQHQTQQQEQQEEDTTGESVVEHSRSGAAGE
VLEYPASFYYHTVGDSRRGPGSYTEMPRKRSSALPASNRQQQLHNGNGSQNPFIKENYWE
APPTRASLLLHSPTEYSEEPQQQQQIQQQQQQQQQQQQQQQQQQQQHLHASARRAYHQQR
EQVYGINQRPQQQQQQNILRVGRSPVNRSFPQQHQQQQQQQQQQQQQQQQQQQPHQQIPT
ARSNPCADGLTPLASHYLYGSKSSLDQHPGDWEPREQRKLRLREERERERERERERERER
EREHLLLEQQQQLQLQEVQVARDNHLSHLAGQQQQQQQRKRHVYGEERERERDRERDMDR
DHRLVNGNADPNESWQHLRVTTETLAEEGGKHGKPADKAQHQMHNTNQSQNSDVNVYREH
QLDAWKLERSYTLAVESRHGIIEYEGSPRRIGVTTTSNLGATGAAAASAAADESEPPAAA
EGAAAATATSQPQQQVPMATVPPLSSTATSLQKTAARAALAALAQSHPHSSHNILSTLLP
HSPNPVNPGQMHAAQQSIQNYPVRPGFPQRIISPPSRDPRSSSPPLQQQQYQQQQQQQLQ
HQQQHFASLMSSHSNNNSNTNKQPLSSDNNAEDTSNDVSEIGTISDLTTPEAVGLSIGIA
AGEMASRASTPPQTAQAPPTAVAGSTANGTGSGNGTATGNATAAGSGLGPLSLHTKSSTF
DYLYEFSETRKVLEEFFKCPSTDEQPIMENGSDVDSIDIQYEFHSNFERDEEDLAEEEEA
EDDEEVDDDADEENDEAEDEDEPLEQDRDQNYRAQAPPQSGHIDSERLVYSGYGQQPQLQ
AQLTAQPMSGARRHYSGSPLMRDFDFFLDSTSRSSGERDADQDGLNHNQLLSTSSGHGGG
VGVSGGLGVGPGGGHNYRYSPETTDYDSNCGDLDSLSGEMNGGVSTSCSNYAKFYASAMP
VLEDGLSSGHTSDTENNNNNQKNLQQSTVNQGGQCPTSLSGSTSIGGSGGISMLMDMKRI
STNHSLNSMNNQTTTASTTTDSNGGVGGVGHHLVATLVASPNNEQAKSQCQTQLQSHPPK
TLSLDQSPSNHSKVFKNIDPELDSLYSIGVFHRPDTVQMTPPPPAPAPHRKPNNNGCSSG
VVNTNGSLAGGSNDVDLLQPSSKHTPLAAAISSTLQRSSPTSTITGNGIGNGSGKTRSAG
SNCSSSANGGMPPPIPERTNLVSAVQRSPSPGPNSPVWLSRHLDGGAGKDLLESGSDNHS
KNHSADEEDVDTDLETDRLLGHQRLDDQGYYDENKSWDRKPRSLLSKISPKQQIPSTKTR
NGYNALLSSTPELPPPIPPKGQSGLGLGLTLGAGNGGKLLDLVGGMVQRSLSRSSSEHSE
KSLSKMPISGGDLCAGGVDVVASTVAATSATVVASTPALGSPGNGGGSERSAAEMANPGG
AVKLSEQEIGTINGGSVMPLGSGSGTGSGAGSGAGSGTGTNAAVVANSNANNNVGGGGGG
GNNSSGSGAGSNSNSGEKKVKKSKSKEGGAVLIEGVLFRAKYLGSTQLVCEGQPTKSTRM
MQAEEAVSRIKALAPDGDVQPSTEVDLFISTEKIMVLNTDLKEIMMDHALRTISYIADIG
DLVVLMARRRFVPQDIDDAPKPNRTPKMICHVFESDEAQFIAQSIGQAFQVAYMEFLKAN
GIEDHRFVKEMDYQEVLNSQEIFGDELEIFAKKELQKEVVVPKAKGEILGVVIVESGWGS
MLPTVVIANLMSSGAAARCGQLNIGDQLIAINGLSLVGLPLSTCQTYIKNTKNQTVVKFT
VVPCAPVVEVKIKRPETKYQLGFSVQNGVICSLLRGGIAERGGVRVGHRIIEINNQSVVA
VPHEKIVNLLATSVGEILMKTMPTSMFRLLTGQENPIYI
Download sequence
Identical sequences Q9W2S5
FBpp0071422 FBpp0071422 NP_727440.3.81976 7227.FBpp0071422 FBpp0071422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]