SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071426 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071426
Domain Number 1 Region: 30-109,145-174
Classification Level Classification E-value
Superfamily POZ domain 1.13e-25
Family BTB/POZ domain 0.0083
Further Details:      
 
Domain Number 2 Region: 276-403
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.17e-16
Family Galactose-binding domain 0.02
Further Details:      
 
Domain Number 3 Region: 463-552
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000284
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071426   Gene: FBgn0030228   Transcript: FBtr0071497
Sequence length 722
Comment type=protein; loc=X:join(10662754..10663326,10663381..10664019,10664088..10664534,10664596..10665105); ID=FBpp0071426; name=CG1826-PA; parent=FBgn0030228,FBtr0071497; dbxref=FlyBase:FBpp0071426,FlyBase_Annotation_IDs:CG1826-PA,GB_protein:AAF46616.1,REFSEQ:NP_572649,GB_protein:AAF46616,FlyMine:FBpp0071426,modMine:FBpp0071426; MD5=c9b3554438e367d65bb5849b10a4a695; length=722; release=r5.30; species=Dmel;
Sequence
MSSQGHHKMSGGGKKGAMEQDYTDVVDLGDRFSADMARLCMNEQYADVEFIVEEERIPAH
RVILAARSEYFRALLYGGMAETTQRQIPLEVPLEAFKVLLRYIYSGTLLLSTLDEDSTID
VLGMANQYGFQDLEMAISNYLRQYLALDNVCMILDAARLYNLEELTEVCLMFMDRNAGDL
LLHNSFNTLSKESLEEVLRRDCFFAPEVQIFLAVWKWSRFNSNVDFKSVVSYVRLPLMNL
EHLLQVVRPSGILDPDKILDAIDERSTSKALPYRAALWPEENVAAETFLSRCIQGECRDA
LLDGDVTTYDMENGYTRHCITDSKDAGIVVELGTFCMINHIRMLLWDRDSRAYSYYVEVS
GDQQHWDRVVDYSDYHCRSWQYLYFEARPVRFIRLVGTQNTVNRVFHVVGLEAMHTAKVP
RLVNHFVAPKTNVATVEMSAIVTDGVSRTRNALINGDYVRYDWDSGYTCHQLGSGEIVVR
LGQPYYLGSMRLLLWDCDDRTYSFYIEISTNRKEWQMVVDRRNDRTRSWQNFHFTPRPVV
YIRIVGTRNTANEIFHCVHLECPTQDKNYLKKIADMEKEREKREKEKKTAKTDDDNIAST
SGSSLASGHAESPSTSSSSSQSVLRSIHWPPQTREVAVAPLTPPALSPPGTPALPAPLTP
ATSSPHNNHEQNQPSNISADASHHTSPSSRSNPSPSLSRSRSQSAELEPVPPLVELDTRE
TL
Download sequence
Identical sequences Q9W2S3
7227.FBpp0071426 FBpp0071426 NP_001259431.1.81976 NP_572649.1.81976 FBpp0071426 FBpp0071426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]