SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071681 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071681
Domain Number 1 Region: 101-306,614-641
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-41
Family Kelch motif 0.03
Further Details:      
 
Domain Number 2 Region: 16-61
Classification Level Classification E-value
Superfamily F-box domain 0.000000000327
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071681   Gene: FBgn0034704   Transcript: FBtr0071767
Sequence length 667
Comment type=protein; loc=2R:join(18062642..18062822,18062881..18064262,18064320..18064760); ID=FBpp0071681; name=CG6758-PA; parent=FBgn0034704,FBtr0071767; dbxref=FlyBase:FBpp0071681,FlyBase_Annotation_IDs:CG6758-PA,GB_protein:AAF46812.1,REFSEQ:NP_611647,GB_protein:AAF46812,FlyMine:FBpp0071681,modMine:FBpp0071681; MD5=358738af3a0d6b74185290230bb81338; length=667; release=r5.30; species=Dmel;
Sequence
MDASRYKVDGENDNCGATLAAVNLNVLPDEILEFIFTYLPPYGDLEHCSLVCKRWHAIVK
NLVRRSRHNLEKGLIDFRLRWEVFSQQTVNGGAGALLSFIAGRFAHSAVRQDNSMYVFGG
GSSSDTTFNDLWRFDLTHMRWARPVATGTYPSPKGSASMVAWRNQLILFGGWRYPSLHPP
YQPWCLFDELHYYDLGKNRWLLRSSLSSPPPMAGHSATVHGDRMVVFGGYQIKDDFNVNS
NDTWVLDLPEQRWWQPLFVGNTRPSPRYGQIQVELGRNHLLIVGGCGGANRVYTDAWLLD
MTRDVWSWKSIAVRNKRFGAVHMWCNPGCKVNNYLVVVGPSPNMPQDFQMMKQSRVPVVG
GRGPPPPNPLQNVPPRGYRIPVPDRRLGGGGLGGPGQNRGGNIRPGVGGAAAALGPQEQY
LANRRAILNQHMQQAQQFLHNSNVNNNNNNYQPRSGRLSDLHAPPAAAAAASPPSPPVRP
NAPPSPADGDVDAAQRLQRNLALRCRDNEPRLPKRFDELYEDPFRMAAFNVPTRSRSASR
DHNERIRRMEEKMNAIRNSRRSAPAAAQVEPQPLRAPSPKRLRCNVQSLFVCDISGILDS
SEPALEWVEYKNFGVLKGAPDRLILSSLIAGNGELILFGGVHKETLTDITHHVSNSIHFL
SVPRDII
Download sequence
Identical sequences Q9W281
FBpp0071681 FBpp0071681 7227.FBpp0071681 NP_611647.1.81976 FBpp0071681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]