SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071779 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071779
Domain Number 1 Region: 20-46
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000133
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071779   Gene: FBgn0034763   Transcript: FBtr0071868
Sequence length 150
Comment type=protein; loc=2R:join(18558612..18558750,18559135..18559448); ID=FBpp0071779; name=RYBP-PA; parent=FBgn0034763,FBtr0071868; dbxref=FlyBase:FBpp0071779,FlyBase_Annotation_IDs:CG12190-PA,GB_protein:AAF46885.2,REFSEQ:NP_611705,GB_protein:AAF46885,FlyMine:FBpp0071779,modMine:FBpp0071779; MD5=206fcb550a08d2ced2b0bb94024e4708; length=150; release=r5.30; species=Dmel;
Sequence
MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALV
AQQAATLPGASVNMPNGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTAQTREVTVNSVT
VFITEYKAKPVSSRRESSEQSFSESNDSRS
Download sequence
Identical sequences Q9W215
FBpp0071779 FBpp0071779 NP_001286742.1.81976 NP_611705.1.81976 7227.FBpp0071779 FBpp0071779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]