The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0071847 |
| Domain Number 1 |
Region: 13-51 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Ran binding protein zinc finger-like |
0.00000000000201 |
| Family |
Ran binding protein zinc finger-like |
0.0012 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 93-130 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Ran binding protein zinc finger-like |
0.0000000000216 |
| Family |
Ran binding protein zinc finger-like |
0.0025 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Molecular Function |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0071847 Gene: FBgn0034750 Transcript: FBtr0071936 |
| Sequence length |
282 |
| Comment |
type=protein; loc=2R:complement(18526543..18526985,18527042..18527358,18527436..18527524); ID=FBpp0071847; name=CG3732-PA; parent=FBgn0034750,FBtr0071936; dbxref=FlyBase:FBpp0071847,FlyBase_Annotation_IDs:CG3732-PA,GB_protein:AAF46870.1,REFSEQ:NP_611692,GB_protein:AAF46870,FlyMine:FBpp0071847,modMine:FBpp0071847; MD5=5c9bdb57ebb2df0f249c4e05f6c64a15; length=282; release=r5.30; species=Dmel; |
| Sequence |
MSSSNGGVASGAAGSSGVASPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRD
RDRERERGNGSSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTC
NMCNAPKFSDVEERTGFGGGYNDRGVVEYKDRQDSDSEYDEFGRRKKRKHGEHREDSKRP
RRSSRDEQRNDEEEDEDDDEGDDEDLSKYDLWGDEEVTSTDVKSKEGTGNGDKERKRTSR
DSTSSVSSSSSSSSSSSSDSSSSSSSSSSSGGRRKTSSSGRR
|
| Download sequence |
 |
| Identical sequences |
Q9W230
NP_611692.1.81976 FBpp0071847 7227.FBpp0071847 FBpp0071847 FBpp0071847 |
