SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071862 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071862
Domain Number 1 Region: 87-129
Classification Level Classification E-value
Superfamily PA domain 0.0000000068
Family PA domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071862   Gene: FBgn0034803   Transcript: FBtr0071951
Sequence length 196
Comment type=protein; loc=2R:join(18825387..18825682,18826013..18826307); ID=FBpp0071862; name=CG9849-PA; parent=FBgn0034803,FBtr0071951; dbxref=FlyBase:FBpp0071862,FlyBase_Annotation_IDs:CG9849-PA,GB_protein:AAF46933.1,REFSEQ:NP_611740,GB_protein:AAF46933,FlyMine:FBpp0071862,modMine:FBpp0071862; MD5=db00e3ba86e23f7abceef657bb268a8c; length=196; release=r5.30; species=Dmel;
Sequence
MLIAWLVLAATLSRSIRASTTISIPITTQDIIAGDVFFEILSPSELEYTYRLRPAKDFGS
AFSERLEGVPLVITDPPGACQEIRNARDLNGGVALIDRGECSFLTKTLRAEAAGALAAII
TEYNPSSPEFEHYIEMIHDNSQQDANIPAGFLLGKNGVIIRSTLQRLKRVHALINIPVNL
TFTPPSKINHPPWLGW
Download sequence
Identical sequences A0A0B4JCU5 Q9W1W9
NP_001188993.1.81976 NP_611740.1.81976 FBpp0071862 FBpp0292026 FBpp0071862 FBpp0071862 FBpp0292026 7227.FBpp0071862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]