SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071973 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071973
Domain Number 1 Region: 601-945
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-79
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 268-412,531-578
Classification Level Classification E-value
Superfamily ARM repeat 3.17e-58
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00055
Further Details:      
 
Domain Number 3 Region: 36-165
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.09e-35
Family PLC-like (P variant) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071973   Gene: FBgn0015277   Transcript: FBtr0072064
Sequence length 949
Comment type=protein; loc=2R:join(19448096..19448166,19448242..19448863,19448921..19449102,19449158..19450050,19450122..19450395,19450470..19450831,19450890..19451335); ID=FBpp0071973; name=Pi3K59F-PA; parent=FBgn0015277,FBtr0072064; dbxref=FlyBase:FBpp0071973,FlyBase_Annotation_IDs:CG5373-PA,GB_protein:AAF47030.2,REFSEQ:NP_477133,GB_protein:AAF47030,FlyMine:FBpp0071973,modMine:FBpp0071973; MD5=283737a681cd4369124cb8889e1bcf94; length=949; release=r5.30; species=Dmel;
Sequence
MDQPDDHFRYIHSSSLHERVQIKVGTLEGKKRQPDYEKLLEDPILRFSGLYSEEHPSFQV
RLQVFNQGRPYCLPVTSSYKAFGKRWSWNEWVTLPLQFSDLPRSAMLVLTILDCSGAGQT
TVIGGTSISMFGKDGMFRQGMYDLRVWLGVEGDGNFPSRTPGKGKESSKSQMQRLGKLAK
KHRNGQVQKVDWLDRLTFREIEVINEREKRMSDYMFLMIEFPAIVVDDMYNYAVVYFEPE
GDVKYKLPAKPKLVSVPDSEIQMENLVERKHHRLARSERSGISDRDAKPTASIRDQLHTI
VYRYPPTYVLSSEEQDLVWKFRFYLSSHKKALTKFLKCINWKLEDEVTQALWMLANWAPM
DVEDALELLSPTFTHPQVRKYAVSRLAQAPDEDLLLYLLQLVQALKYEDPRHIVHLHGCI
FPERDVVRSILDDNGSLLDQSSLSDLSATSSGLHGSVIPANQRAASVLAAIKSDKSVSPG
SAGGSGSGGQGSVALPNPSAPATPGSSSLPCDSNSNALMLAEGISFGSVPANLCTFLIQR
ACTNATLANYFYWYLSIEVEEVESVRKQDERAHDMYAMVLKMFLKVLENGNFNLRGIFYN
LRKQRRFIDELVKLVKLVAKEPGNRNKKTEKFQKLLAEQDMFKVNFTNFEPIPFPLDPEI
YITKIVPMRTSLFKSALMPAKLTFVTSIAHHEYAAIFKHGDDLRQDQLILQMITLMDKLL
RRENLDLKLTPYKVLATSSKHGFLQYVDSCTVAEVLAREGNIHNFFRKHHPCDNGPYGIS
AEVMDTYIKSCAGYCVITYLLGVGDRHLDNLLLTTNGKLFHIDFGYILGRDPKPMPPPMK
LSKEMVEAMGGISSEHHHEFRKQCYTAYLHLRRHANVMLNLFSLMVDATVPDIALEPDKA
VKKVEENLQLGLTDEEAVQHLQSLLDVSITAVMPALVEQIHRFTQYWRK
Download sequence
Identical sequences Q9W1M7
FBpp0071973 NP_477133.1.81976 FBpp0071973 7227.FBpp0071973 FBpp0071973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]