SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071981 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071981
Domain Number 1 Region: 272-394
Classification Level Classification E-value
Superfamily ARID-like 1.7e-35
Family ARID domain 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071981   Gene: FBgn0004795   Transcript: FBtr0072072
Sequence length 906
Comment type=protein; loc=2R:join(19520701..19520787,19529762..19529928,19530007..19530157,19530282..19530618,19530695..19530795,19535212..19535284,19538424..19538607,19538958..19539105,19539183..19539676,19540026..19540124,19540280..19540803,19540986..19541341); ID=FBpp0071981; name=retn-PA; parent=FBgn0004795,FBtr0072072; dbxref=FlyBase:FBpp0071981,FlyBase_Annotation_IDs:CG5403-PA,GB_protein:AAF47037.3,REFSEQ:NP_476864,GB_protein:AAF47037,FlyMine:FBpp0071981,modMine:FBpp0071981; MD5=1650ea9e8c4bc7b60e068d250045885f; length=906; release=r5.30; species=Dmel;
Sequence
MQLRVHPTMDCSGRSTSNIERDSDLGDDLSHGDRTDDEMRDCDSVDGEHHQLSAKAAIAA
RLSHTVSGGGGSFASPEPQTELPLSHHHQLPPNHPLNALGSFMGIGGLHSIPNLQHSDVL
EKLKMQVRDMKVGLMEQDYAAAAHAAAFGANMLPTTISSGFPLPHNSVAFGHVTSSPSGG
NGSSYNGGTTPTNSSNSNATTNGGGTAGPGGTGGSGGGGGGGGGGGGGVGGHQFSFASPT
AAPSGKEANSASNSSTSSEASNSSQQNNGWSFEEQFKQVRQLYEINDDPKRKEFLDDLFS
FMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSA
AFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRREGRRSSYGQYEAMHNQMPMTPIS
RPSLPGGMQQMSPLALVTHAAVANNQQAQAAAAAAAAHHRLMGAPAFGQMPNLVKQEIES
RMMEYLQLIQAKKEQGMPPVLGGNHPHQQQHSQQQQQQQHHHQQQQQQQSQQQHHLQQQR
QRSQSPDLSKHEALSAQVALWHMYHNNNSPPGSAHTSPQQREALNLSDSPPNLTNIKRER
EREPTPEPVDQDDKFVDQPPPAKRVGSGLLPPGFPANFYLNPHNMAAVAAAAGFHHPSMG
HQQDAASEGEPEDDYAHGEHNTTGNSSSMHDDSEPQQMNGHHHHQTHHLDKSDDSAIENS
PTTSTTTGGSVGHRHSSPVSTKKKGGAKPQSGGKDVPTEDKDASSSGKLNPLETLSLLSG
MQFQVARNGTGDNGEPQLIVNLELNGVKYSGVLVANVPLSQSETRTSSPCHAEAPTVEEE
KDEEEEEEPKAAEEESHRSPVKQENEDVDQDMEGSEVLLNGGASAVGGAGAGVGVGVPLL
KDAVVS
Download sequence
Identical sequences FBpp0071981 NP_476864.2.81976 FBpp0071981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]