SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0071982 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071982
Domain Number 1 Region: 277-399
Classification Level Classification E-value
Superfamily ARID-like 1.7e-35
Family ARID domain 0.000000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071982   Gene: FBgn0004795   Transcript: FBtr0072073
Sequence length 911
Comment type=protein; loc=2R:join(19520701..19520787,19529762..19529928,19530007..19530157,19530282..19530618,19530680..19530795,19535212..19535284,19538424..19538607,19538958..19539105,19539183..19539676,19540026..19540124,19540280..19540803,19540986..19541341); ID=FBpp0071982; name=retn-PB; parent=FBgn0004795,FBtr0072073; dbxref=FlyBase:FBpp0071982,FlyBase_Annotation_IDs:CG5403-PB,GB_protein:AAO41347.1,REFSEQ:NP_788434,GB_protein:AAO41347,FlyMine:FBpp0071982,modMine:FBpp0071982; MD5=4b7c8e53d596a32ccf3d35b28c8b2fba; length=911; release=r5.30; species=Dmel;
Sequence
MQLRVHPTMDCSGRSTSNIERDSDLGDDLSHGDRTDDEMRDCDSVDGEHHQLSAKAAIAA
RLSHTVSGGGGSFASPEPQTELPLSHHHQLPPNHPLNALGSFMGIGGLHSIPNLQHSDVL
EKLKMQVRDMKVGLMEQDYAAAAHAAAFGANMLPTTISSGFPLPHNSVAFGHVTSSPSGG
NGSSYNGGTTPTNSSNSNATTNGGGTAGPGGTGGSGGGGGGGGGGGGGVGGHQFSFASPT
AAPSGKEARHFAANSASNSSTSSEASNSSQQNNGWSFEEQFKQVRQLYEINDDPKRKEFL
DDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPS
SITSAAFTLRTQYMKYLYPYECEKKNLSTPAELQAAIDGNRREGRRSSYGQYEAMHNQMP
MTPISRPSLPGGMQQMSPLALVTHAAVANNQQAQAAAAAAAAHHRLMGAPAFGQMPNLVK
QEIESRMMEYLQLIQAKKEQGMPPVLGGNHPHQQQHSQQQQQQQHHHQQQQQQQSQQQHH
LQQQRQRSQSPDLSKHEALSAQVALWHMYHNNNSPPGSAHTSPQQREALNLSDSPPNLTN
IKREREREPTPEPVDQDDKFVDQPPPAKRVGSGLLPPGFPANFYLNPHNMAAVAAAAGFH
HPSMGHQQDAASEGEPEDDYAHGEHNTTGNSSSMHDDSEPQQMNGHHHHQTHHLDKSDDS
AIENSPTTSTTTGGSVGHRHSSPVSTKKKGGAKPQSGGKDVPTEDKDASSSGKLNPLETL
SLLSGMQFQVARNGTGDNGEPQLIVNLELNGVKYSGVLVANVPLSQSETRTSSPCHAEAP
TVEEEKDEEEEEEPKAAEEESHRSPVKQENEDVDQDMEGSEVLLNGGASAVGGAGAGVGV
GVPLLKDAVVS
Download sequence
Identical sequences Q24573
NP_788434.1.81976 FBpp0071982 FBpp0071982 FBpp0071981 7227.FBpp0071982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]