The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0072020 |
| Domain Number 1 |
Region: 171-295 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Eukaryotic type KH-domain (KH-domain type I) |
9.1e-37 |
| Family |
Eukaryotic type KH-domain (KH-domain type I) |
0.0000293 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 77-169 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Nucleic acid-binding proteins |
3.6e-24 |
| Family |
Cold shock DNA-binding domain-like |
0.0000181 |
| Further Details: |
|
| |
| Domain Number 3 |
Region: 29-79 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Ribosomal L27 protein-like |
0.00000000000314 |
| Family |
ECR1 N-terminal domain-like |
0.0019 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Biological Process |
IC (bits) |
H-Score |
| Cellular Component |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0072020 Gene: FBgn0034879 Transcript: FBtr0072111 |
| Sequence length |
298 |
| Comment |
type=protein; loc=2R:complement(19442702..19443151,19443215..19443661); ID=FBpp0072020; name=Rrp4-PA; parent=FBgn0034879,FBtr0072111; dbxref=FlyBase:FBpp0072020,FlyBase_Annotation_IDs:CG3931-PA,GB_protein:AAF47028.1,REFSEQ:NP_611807,GB_protein:AAF47028,FlyMine:FBpp0072020,modMine:FBpp0072020; MD5=764f0e294fd8eb42280ea1ccdaaadd97; length=298; release=r5.30; species=Dmel; |
| Sequence |
MSTNAAIDLALDRVDWRDLAAQTEEQPRVYTPGEVLMPEAGFMRGHGTFVEDENIKSSVA
GVIQKVNKLISVRPLKSRYVGEIGDVVVARVSEVQQKRWRVDTNSRLDSILLLSSVNLPG
GELRRRSAEDEQMMRRYLDEGDLISAEVQNIFEEGSLSLYTRSLKYGKLSQGILVKVFPA
LVKRRKMHFHNLPCGASVILGNNGYIWISPTKGQEEEGGEGGFAQNLNEHVPRADREVIA
RLRNSILALAKCKLMIYDTSIQYAYEESLRYEAHELLQQNAIYDIGQQTQARLRDADE
|
| Download sequence |
 |
| Identical sequences |
Q9W1M9
7291605___KOG3013 NP_001286771.1.81976 NP_611807.1.81976 FBpp0072020 FBpp0072020 FBpp0072020 7227.FBpp0072020 |
