SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072041 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072041
Domain Number 1 Region: 103-359
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 3.79e-79
Family ATP-dependent DNA ligase DNA-binding domain 0.000000532
Further Details:      
 
Domain Number 2 Region: 362-579
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.12e-54
Family ATP-dependent DNA ligase catalytic domain 0.00000014
Further Details:      
 
Domain Number 3 Region: 581-727
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-50
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072041   Gene: FBgn0034922   Transcript: FBtr0072132
Sequence length 747
Comment type=protein; loc=2R:join(19778119..19778135,19778193..19778255,19778311..19778601,19778662..19779294,19779350..19779975,19780029..19780642); ID=FBpp0072041; name=CG5602-PA; parent=FBgn0034922,FBtr0072132; dbxref=FlyBase:FBpp0072041,FlyBase_Annotation_IDs:CG5602-PA,GB_protein:AAF47090.3,REFSEQ:NP_611843,GB_protein:AAF47090,FlyMine:FBpp0072041,modMine:FBpp0072041; MD5=0b59cd846cca37c95dcbc8986706f07d; length=747; release=r5.30; species=Dmel;
Sequence
MQKSITSFFKKKSDATDSPSPPKKVPKIDAKTELPDEPHIKSESASPETKPKVEPMSVDS
EEKTSPVKNVKKEPKEVDDKTTDKKVTTIGLNSTAATKEDVENYDPSADSYHPLKNAYWK
DKKVTPYLALARTFQVIEETKGRLKMIDTLSNFFCSVMLVSPEDLVPSVYLSINQLAPAY
EGLELGVAETTLMKAICKATGRNLAHIKSQTQLTGDLGIVAEQSRVSQRMMFQPAPLNVR
DVFRKLREIAKLSGQSKMDLVYNMFVACRSSEARFFIRSLIGKLRIGIAEQSLLTALAIG
LVKKNHIDDCKASKVPDVYKDEIVDTTLLLKTAYCQCPNYDIIIPAILKYDIKELQERCP
MHPGMPLRPMLAQPTKGVHEVFERFGGMQITCEWKYDGERAQIHRNEKGEISIFSRNSEN
NTAKYPDLIARSTALLKGDVKSYIIDSEIVAWDVERKQILPFQVLSTRKRKNVDIEEIKV
QVCVYIFDLLYINGTALVTKNLSERRKLLLEHFQEVEGEWKFATALDTNDIDEVQQFLEE
SIKGNCEGLMVKTLDEEATYEIAKRSRNWLKLKKDYLSNVGDSLDLVVIGGYKGKGRRTG
TYGGFLLACYDTENEEYQSICKIGTGFTDEDLQTHSEFLGKHVTSAAKSYYRYDPSLEPD
HWFEPVQVWEVKCADLSLSPIHRAAIGIVDGERGISLRFPRFIRIRDDKNSENATDANQV
AHMYQSQDQVKNNQKSSTQMEMEDEFY
Download sequence
Identical sequences Q9W1H4
FBpp0072041 7227.FBpp0072041 NP_611843.2.81976 FBpp0072041 FBpp0072041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]