SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072077 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072077
Domain Number 1 Region: 1659-1786,1901-2027
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000408
Family GUN4-associated domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072077   Gene: FBgn0034964   Transcript: FBtr0072168
Sequence length 2053
Comment type=protein; loc=2R:join(19925585..19926902,19926964..19927943,19927998..19931861); ID=FBpp0072077; name=CG3173-PA; parent=FBgn0034964,FBtr0072168; dbxref=FlyBase:FBpp0072077,FlyBase_Annotation_IDs:CG3173-PA,GB_protein:AAF47145.2,REFSEQ:NP_611875,GB_protein:AAF47145,FlyMine:FBpp0072077,modMine:FBpp0072077; MD5=effd6f54717e17ae2f6bf023c6628fef; length=2053; release=r5.30; species=Dmel;
Sequence
MDRGKGSGSNRSQKKVPLGGELFALGKSVRDDSKSKILPIKGMSSSDRKREASTALASSS
KRFRGNLKDAGAPDMSSGSSQCETWEQFAVDCDLDTVVETIYAALEQNDSETVGRLVCGV
IKQTTTSSSRSKVDNIALLALIYVAKVQPSIFCTDIVACALLSFLRREANVKMRYNTNLH
ILFANLLTRGFMEISQWPEVLLRIYIDDAVNERYWADNELCAPLVKNICAAFKTRTPHIS
LLRWDVSSSLPSGQAHRDSMTVDDDSGDNSTQSLDASPLNTESEPIPDAMCTTKSRFSDA
VVQKHVSDAIRDQLNKRQQQDNYTRNFLKFLCTTSGIAEVRCLSISRLELWIHNGKLVKF
AQQLLSYICFNIKGRNTQDNEVLLVLVKMRLKTKPLINHYMSCLKEMIFLQPEILSTVMK
LVVQNELSNTRNPNNMGMLATMFQTSADQSAATLAEIYQEFLLQRDDCLRTLRVFLRELV
RMLRFDVNLVKFCKTFLSEREDLTPQIEMFEFKERIFNSMVDIVCLCMFLSATPQAREAS
LSLKTNRDTKNNHALLKLYNQMSQIQLDTVSWMYETVPTLFKIPAAEYHQALHKLLLLDS
PEQYSRCDQWPSEPERGAILRIISETPIHEETLLRIILIGITKDIPFSIANTFDVLLLVI
KRVSGMKATNIPAVQANKFDIIDFLFSMSEYHHPENIRLPAEYEPPKLAIIAFYWKAWLI
LLMISAHNPSSFGAFCWDHYPTMKMMMEICITNQFNNSSATKDELQIITMERDHILQFET
YLAAQTSPHAVITEETAILITQLMLMDPMGTPRKVPSMVLDQLKFLNQTYKLGHLFCRCR
KPDLLLDIIQRQGTTQSMPWLSDLVQNSEGDFSHLPVQCLCEFLLFNAHIINEENSRDAE
LVNFLRNLIFDGNLSHQIVCELLDYIFRRLSSTVKQSRVAALSGLKIIFRHSGDFENEWL
LKSLQQIPHFYEVKPFIIPQLRAACQVENCPELIMAYIQFITAHTLNDPVNEMLDHVIDM
AQLIVERSTMFQHIIISQEDYDYVPDENRIQTLKCLFVMFNNYIIKLREYHEPYEWTEYP
DLLMVQFDDGVQLPLHINIIHAFIILLTYSNSNMPESIPILDYWFPPGRPAPVAFLPSMP
QEQVQLLPDWLKLKMIRSSVDRLIEAALNDLTPDQIVLFVQNFGTPVNSMSKLLAMLDTA
VLEQFDLVKNAILNKAYLAQLIEIQQARGAKNGHYTVQALDLHSHSQTVPDLPKISVVIQ
EAVEIDDYDSSDSDDRPTNFLATKEVAQTILTQPDQLTESRSDCRSLIQKLLDMLASPNS
NRADVVNAITEVLAVGCSVTMSRHACTFLRTFFSCMLHSDKYHILENALQKNLSMFKHTF
ADSSLLQKSELYHESLVFMLRNSREIYAQQFKANTALVARKRIVRAIVQSFDQTKDSKTV
AKSKSDQLFHNGLFIDWLSEMDPEIVSTQLMKERFLFSKSCSEFRFYLLSLINHQTNWDT
IERIAEYLFKNFHEDYDYATVLNYFEALTTNPKLWKGRDKYMSKNVRPDAFFMLRTSELE
PFSHFILHEGLSEVKLDSKNYDFKLCSRMNLLFKLTEKRRDLMVKVMEHVEKSSVSDYLK
LQVLQQMYIMYPRIKFLKPGKTGEQAYKLQNLKGCQADKVSNNLITCLGSLVGKKDFETL
STDTELLLRKLAASHPLLFLRQLGVLSSIMQGRAQLSMKALREEHHFHRFVQILRTLELL
QPTIFEEAYKNEIQNTLSCYFNFFKHHSNVKEACQMLNKFVQMLQAYINYNPSSALLFIE
QYVGILKELAAKYTSLGKLQVLVQAVALLQHKSHSATELDDEEVKYEYDLDEHFDVKPSA
SKPVVTEDPIEVNPQTPIDPSSSRGPLSVLTLGSYSRSNYTDISPHFLDLVKIIKQSNTE
DVVLGPMQELECLTSKRFVFINELFERLLNLIFSPSAQIRSIAFIILIRHLKHNPGNSDI
NLCTLNAYIQCLRDENSSVAATAIDNLPEMSVLLQEHAIDILTVAFSLGLKSCLNTGHQI
RKVLQTLVIQHGY
Download sequence
Identical sequences Q9W1C5
FBpp0072077 FBpp0072077 FBpp0072077 NP_611875.1.81976 7227.FBpp0072077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]