SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072361 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072361
Domain Number 1 Region: 292-352
Classification Level Classification E-value
Superfamily RING/U-box 2.59e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Domain Number 2 Region: 102-174
Classification Level Classification E-value
Superfamily PA domain 0.0000000262
Family PA domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072361   Gene: FBgn0004919   Transcript: FBtr0072459
Sequence length 461
Comment type=protein; loc=2R:complement(20960789..20961112,20962765..20962861,20962920..20963071,20963128..20963245,20964697..20964829,20964893..20965454); ID=FBpp0072361; name=gol-PB; parent=FBgn0004919,FBtr0072459; dbxref=FlyBase:FBpp0072361,FlyBase_Annotation_IDs:CG2679-PB,GB_protein:AAM68328.1,REFSEQ:NP_726508,GB_protein:AAM68328,FlyMine:FBpp0072361,modMine:FBpp0072361; MD5=fb5ee31df348f289a447180caca95bb2; length=461; release=r5.30; species=Dmel;
Sequence
MYIRKTLLLACLVLLFGGLPPLTFPATTTTLVAAMSIANQDLERYFRPGNGTHSFSGMED
RIAVDVYNYAFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDY
ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEK
MQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSI
SFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDS
DCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEE
SILEYQPDPPQGLALVEARDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCRIPE
RSQSSLSLRQARDWVSLMSNKLEEQQGLRSMRNDEMQQVIK
Download sequence
Identical sequences Q06003
FBpp0072361 NP_726508.1.81976 FBpp0072361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]