SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072366 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072366
Domain Number 1 Region: 243-394,462-624
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-80
Family Protein kinases, catalytic subunit 0.000000166
Further Details:      
 
Domain Number 2 Region: 565-585,648-767
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-38
Family Pleckstrin-homology domain (PH domain) 0.0000374
Further Details:      
 
Domain Number 3 Region: 183-245
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000602
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 
Weak hits

Sequence:  FBpp0072366
Domain Number - Region: 411-480
Classification Level Classification E-value
Superfamily ARM repeat 0.00501
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072366   Gene: FBgn0020386   Transcript: FBtr0072464
Sequence length 836
Comment type=protein; loc=3L:join(129823..129888,135458..135842,135967..136335,141770..142879,142943..143217,143515..143820); ID=FBpp0072366; name=Pk61C-PD; parent=FBgn0020386,FBtr0072464; dbxref=GB_protein:AAF47330.2,FlyBase:FBpp0072366,FlyBase_Annotation_IDs:CG1210-PD,GB_protein:AAF47330.3,REFSEQ:NP_728471,GB_protein:AAF47330,FlyMine:FBpp0072366,modMine:FBpp0072366; MD5=8826f7dc76c3d3334b2912d555c5c096; length=836; release=r5.30; species=Dmel;
Sequence
MKCKSWSNKINNYVVRKIKSIKINGTQQQLQLPGSGASGIAAAAVITVASDCGENCSSNG
TEHQQHFNIATTTATSATEATMPAMAKEKASATVSLGESNFRDINLKDLAVVVEAASRLH
HQQNVCGCGAVSSTENNNNSRYGSSKYLTNGHTSPLAAAVASNSSSVATTPHCRMLHNCS
LQQYQNDIRQQTEILDMLRQQHQQGYQSQQQQQQPQQQQEQQQQQEQSQQQQQLQNPAPR
RSPNDFIFGRYIGEGSYSIVYLAVDIHSRREYAIKVCEKRLILRERKQDYIKREREVMHQ
MTNVPGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLLACEH
MHRRNVVHRDLKPENILLDEDMHTLIADFGSAKVMTAHERALATEHCSEQRRSNSDEDDE
DSDRLENEDEDFYDRDSEELDDGDDEQQQEEMDSPRHRQRRYNRHRKASFVGTAQYVSPE
VLQNGPITPAADLWALGCIVYQMIAGLPPFRGSNDYVIFKEILDCAVDFPQGFDKDAEDL
VRKLLRVDPRDRLGAQDEFGYYESIRAHPFFAGIDWQTLRQQTPPPIYPYLPGVSQDEDF
RSSYTVPGDLEPGLDERQISRLLSAELGVGSSVAMPVKRSTAKNSFDLNDAEKLQRLEQQ
KTDKWHVFADGEVILKKGFVNKRKGLFARKRMLLLTTGPRLIYIDPVQMIKKGEIPWSPD
LRAEYKNFKIFFVHTPNRTYYLDDPEGYAIHWSEAIENMRKLAYGDPSSTSAVSCSSGSS
NSLAVISNSSAASSSNSPTVKRSSPVNAPQASTASDNRTLGSTRTGTSPSKKTASK
Download sequence
Identical sequences H5V8B9 Q9W0V1
FBpp0072366 FBpp0305420 NP_001261183.1.81976 NP_728471.2.81976 FBpp0072366 7227.FBpp0072366 FBpp0072366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]