SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072387 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072387
Domain Number 1 Region: 508-942
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.63e-115
Family RNB domain-like 0.000000734
Further Details:      
 
Weak hits

Sequence:  FBpp0072387
Domain Number - Region: 410-519
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00113
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072387   Gene: FBgn0035111   Transcript: FBtr0072485
Sequence length 1032
Comment type=protein; loc=3L:join(212845..213976,214032..215451,215505..215624,215683..216109); ID=FBpp0072387; name=CG16940-PB; parent=FBgn0035111,FBtr0072485; dbxref=FlyBase:FBpp0072387,FlyBase_Annotation_IDs:CG16940-PB,GB_protein:AAN11426.1,REFSEQ:NP_728491,GB_protein:AAN11426; MD5=fbdd2e7d519dc48d8dca6687d469ce11; length=1032; release=r5.30; species=Dmel;
Sequence
MSETSSVNVDADRDCRRIEGLRQRSQRLAARLQQMQREMESNASSKDLSANNAVIPLQPL
MRWAEPRPHPNQSQPSARSNSRQAIPYGVPVSTPAPVAMQLPYHVAFASYQATMQIPCLQ
PLSHLHVVSSPSHRLIAKKKSKRALRNEVEALQDMVKHLSHLSPDVNAYACQLIRKNEIL
SQLEWSQTRSEAHPQQVGYQGRHRHDSEVSATNNGSHVQQQPKLGRRQRNSKKNDGSGSN
GTQSQKTELEAMRSYINKIVQRHVGMDHQLSEDLIFKGNFSDLEAHAQRLVAAGYGRIVE
EEIRVNRKNNRQAFIIMSTDREALERDGIVLLPVARRYAFDGDKVRAFVLNPGAQGSSKT
AEPSSGEISGGKPSLSLADGEELSDDTESQGSESDTDNVVVISSDNCPKAFVIAITKRTE
LRQIVGTISFTNPTKLCDDQLFYKFRPYDLRVPMVYVPKDACAAHIGNKQQIDVSGLLYL
AHILETDCNGHCIAELIQPVGRVGNLDDELKAILFHNGLRDIKPFEQRFIDIYSQPPPPI
SQEDLRQRKDLRKMCIFTIDPMTARDLDDAVSIEKLGDNEYEIGVHISDVSHFLIEDNEL
DNIVKERSTSIYLANEVIHMLPQSLCMRCSLLPGQDKFAFSVFWRMNGKGVMLQKKPEFC
RTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPDDIRNRVLWLHDIASSIRKT
RLDNGALTINNAKLRFLLDPITGEPLSFEVEKQREANRLIEEFMLLANQAVARFIHDSFP
DIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNEAPNPVAMNACLS
QLLMKPMARATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDILVHRLLAAALKYC
TPPKRTPDDLHTLTKLANERKYNAKKAGEDSGNLYFKRYVHNKQGIYMRAVVIEIFQHMM
NVVTLESGHVISINYKMQKVLVDTHGVPNYILIAERNLKQSPRKLQLLSVVPICLIIWDQ
KLTGFLKMEEQI
Download sequence
Identical sequences Q9W0T7
FBpp0072387 FBpp0072389 FBpp0072389 NP_612012.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]