SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072388 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072388
Domain Number 1 Region: 520-954
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.74e-115
Family RNB domain-like 0.000000734
Further Details:      
 
Weak hits

Sequence:  FBpp0072388
Domain Number - Region: 422-531
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00115
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072388   Gene: FBgn0035111   Transcript: FBtr0072486
Sequence length 1044
Comment type=protein; loc=3L:join(212750..212784,212844..213976,214032..215451,215505..215624,215683..216109); ID=FBpp0072388; name=CG16940-PC; parent=FBgn0035111,FBtr0072486; dbxref=FlyBase:FBpp0072388,FlyBase_Annotation_IDs:CG16940-PC,GB_protein:AAN11425.1,REFSEQ:NP_728490,GB_protein:AAN11425,FlyMine:FBpp0072388,modMine:FBpp0072388; MD5=cbac15537129d184dd399b55febf6957; length=1044; release=r5.30; species=Dmel;
Sequence
MPYPLYPAHSQVMSETSSVNVDADRDCRRIEGLRQRSQRLAARLQQMQREMESNASSKDL
SANNAVIPLQPLMRWAEPRPHPNQSQPSARSNSRQAIPYGVPVSTPAPVAMQLPYHVAFA
SYQATMQIPCLQPLSHLHVVSSPSHRLIAKKKSKRALRNEVEALQDMVKHLSHLSPDVNA
YACQLIRKNEILSQLEWSQTRSEAHPQQVGYQGRHRHDSEVSATNNGSHVQQQPKLGRRQ
RNSKKNDGSGSNGTQSQKTELEAMRSYINKIVQRHVGMDHQLSEDLIFKGNFSDLEAHAQ
RLVAAGYGRIVEEEIRVNRKNNRQAFIIMSTDREALERDGIVLLPVARRYAFDGDKVRAF
VLNPGAQGSSKTAEPSSGEISGGKPSLSLADGEELSDDTESQGSESDTDNVVVISSDNCP
KAFVIAITKRTELRQIVGTISFTNPTKLCDDQLFYKFRPYDLRVPMVYVPKDACAAHIGN
KQQIDVSGLLYLAHILETDCNGHCIAELIQPVGRVGNLDDELKAILFHNGLRDIKPFEQR
FIDIYSQPPPPISQEDLRQRKDLRKMCIFTIDPMTARDLDDAVSIEKLGDNEYEIGVHIS
DVSHFLIEDNELDNIVKERSTSIYLANEVIHMLPQSLCMRCSLLPGQDKFAFSVFWRMNG
KGVMLQKKPEFCRTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPDDIRNRVL
WLHDIASSIRKTRLDNGALTINNAKLRFLLDPITGEPLSFEVEKQREANRLIEEFMLLAN
QAVARFIHDSFPDIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNE
APNPVAMNACLSQLLMKPMARATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDIL
VHRLLAAALKYCTPPKRTPDDLHTLTKLANERKYNAKKAGEDSGNLYFKRYVHNKQGIYM
RAVVIEIFQHMMNVVTLESGHVISINYKMQKVLVDTHGVPNYILIAERNLKQSPRKLQLL
SVVPICLIIWDQKLTGFLKMEEQI
Download sequence
Identical sequences Q8IRJ7
7227.FBpp0072388 FBpp0072387 FBpp0072388 FBpp0072388 NP_728490.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]