SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072903 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0072903
Domain Number - Region: 22-132
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000518
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072903   Gene: FBgn0035413   Transcript: FBtr0073039
Sequence length 145
Comment type=protein; loc=3L:join(3189994..3190014,3190120..3190536); ID=FBpp0072903; name=CG14958-PA; parent=FBgn0035413,FBtr0073039; dbxref=GB_protein:AAF47732.1,FlyBase:FBpp0072903,FlyBase_Annotation_IDs:CG14958-PA,REFSEQ:NP_647782,GB_protein:AAF47732,FlyMine:FBpp0072903,modMine:FBpp0072903; MD5=0f8e9373f09015f64ab0888067576b6e; length=145; release=r5.30; species=Dmel;
Sequence
MYKLLGLIALVAFPIAWIQADCNVCQSNGASCINQTAYNLCFGSTQPNTNQTFVCTDGLV
CTDQPVICFQRGENPASCGDTDSCGQCAPNYTFACTSRSTFAFCFGAITPTNVTGSCPDG
YFCDASTQEICVTKATDDSIICHLN
Download sequence
Identical sequences Q9VZT5
7227.FBpp0072903 FBpp0072903 FBpp0072903 FBpp0072903 NP_647782.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]