SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072928 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072928
Domain Number 1 Region: 6-94,147-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.69e-20
Family Phosphoribulokinase/pantothenate kinase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072928   Gene: FBgn0035436   Transcript: FBtr0073064
Sequence length 323
Comment type=protein; loc=3L:3320745..3321716; ID=FBpp0072928; name=CG12016-PB; parent=FBgn0035436,FBtr0073064; dbxref=FlyBase:FBpp0072928,FlyBase_Annotation_IDs:CG12016-PB,GB_protein:AAN11559.1,REFSEQ:NP_728865,GB_protein:AAN11559; MD5=d79b00b1e72dca3d8524328a04cffb9d; length=323; release=r5.30; species=Dmel;
Sequence
MPQWLVIGISGVTCGGKTTLAHSLHDYFKGLRGAPLWNSPYTIGEVRLISQDDYFLPVED
KRHQRNEALNAINFELITSLDMAKMLNDIAHIIKGRHVAPEPQEHLVTYANFEHYAQQFQ
QQYQYNANYYKQANGGVYQYPPQQHPRHHPHHQQHHHQHHQIQQQQQHIMSINAQIAAQL
RDKKVNFLLVEGFMIFNQPELLALCNIKYHFHLPYEKCFERRSKRTYDPPDVTGYFELCV
WPHYEKNFSEYRDCKDITFLNGEIAKEKILAFVLHRIVHYFKERCEVPAPAPVVCPPQQK
RFGMLYMGPSNNNVMPSACPMEQ
Download sequence
Identical sequences Q9VZR0
7227.FBpp0072928 FBpp0072927 FBpp0072928 FBpp0072927 NP_647805.1.81976 NP_728865.1.81976 FBpp0072927 FBpp0072928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]