SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0072952 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0072952
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-31
Family Phosphotyrosine-binding domain (PTB) 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0072952   Gene: FBgn0035431   Transcript: FBtr0073090
Sequence length 199
Comment type=protein; loc=3L:complement(3299523..3300047,3300723..3300797); ID=FBpp0072952; name=CG14968-PA; parent=FBgn0035431,FBtr0073090; dbxref=FlyBase:FBpp0072952,FlyBase_Annotation_IDs:CG14968-PA,GB_protein:AAF47753.1,REFSEQ:NP_728852,GB_protein:AAF47753; MD5=67ccbc2132e4ab434f534e318b900927; length=199; release=r5.30; species=Dmel;
Sequence
MASNNSSTTDLDSQVNVEDLPITFKVKYIGSEVARGLWGIKYTRRPVDIMVGVAKNLPPN
KVLPNCELKVSTDGVQLEIISPKASINHWSYPIDTISYGVQDLVYTRVFAMIVVKDESSP
HPFEVHAFVCDSRAMARKLTFALAAAFQDYSRRVKEATGEEEGEATPSDTITPTRHKFAI
DLRTPEEIQAGELEQETEA
Download sequence
Identical sequences Q9VZR5
FBpp0072948 NP_647800.1.81976 NP_728852.1.81976 NP_728853.1.81976 NP_728854.1.81976 NP_728855.1.81976 FBpp0072948 FBpp0072949 FBpp0072950 FBpp0072951 FBpp0072952 7227.FBpp0072948 FBpp0072948 FBpp0072949 FBpp0072950 FBpp0072951 FBpp0072952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]