SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073247 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073247
Domain Number 1 Region: 49-95,235-317
Classification Level Classification E-value
Superfamily SET domain 1.44e-16
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Weak hits

Sequence:  FBpp0073247
Domain Number - Region: 100-123
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00628
Family HIT zinc finger 0.054
Further Details:      
 
Domain Number - Region: 99-167
Classification Level Classification E-value
Superfamily YrdC/RibB 0.00824
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073247   Gene: FBgn0030257   Transcript: FBtr0073391
Sequence length 403
Comment type=protein; loc=X:join(10939151..10939168,10941284..10942329,10942512..10942659); ID=FBpp0073247; name=CG11160-PB; parent=FBgn0030257,FBtr0073391; dbxref=FlyBase:FBpp0073247,FlyBase_Annotation_IDs:CG11160-PB,GB_protein:AAN09278.1,REFSEQ:NP_727478,GB_protein:AAN09278,FlyMine:FBpp0073247,modMine:FBpp0073247; MD5=bafe5729d694944de8d9d4b7c3a7ca5f; length=403; release=r5.30; species=Dmel;
Sequence
MPGRKKNHHKNNNNSRARHQRGGQQSKDKQEQQDKEQSPSPTEEKELPYRVEHSDIYGRY
LVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGCAWPLCGSTCA
GLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILLLRQHDPEQFA
LIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQVHEVCGILDVNCFEIGQ
NGAKARTLYPSAFLLAHDCTPNTAHTDDPSSFEILLRTSRRVREREALTLSYAYTLQGTL
KRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVDPLQQTGDWACDRCA
HKMGATEVERQLDRINNDLEDIDVHDIPGLENFLLRCVCIHGS
Download sequence
Identical sequences Q8IR97
NP_727478.1.81976 FBpp0073247 FBpp0073247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]