SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073363 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073363
Domain Number 1 Region: 8-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-84
Family Motor proteins 0.00000847
Further Details:      
 
Domain Number 2 Region: 600-664
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000534
Family ComEA-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073363   Gene: FBgn0002948   Transcript: FBtr0073516
Sequence length 666
Comment type=protein; loc=X:join(11474957..11475073,11475138..11475332,11475403..11475937,11476072..11476217,11478339..11478529,11478593..11479303,11479382..11479487); ID=FBpp0073363; name=nod-PA; parent=FBgn0002948,FBtr0073516; dbxref=FlyBase:FBpp0073363,FlyBase_Annotation_IDs:CG1763-PA,GB_protein:AAF48064.2,REFSEQ:NP_511125,GB_protein:AAF48064,FlyMine:FBpp0073363,modMine:FBpp0073363; MD5=0329865f97265fe516b50760eb9c1d65; length=666; release=r5.30; species=Dmel;
Sequence
MEGAKLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQ
DEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDI
FERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADL
HHILELGTRNRRVRPTNMNSNSSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVRRTGHEG
VARQEGVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPH
QCDLSETLSTLRFGTSAKKLRLNPMQVARQKQSLAARTTHVFRQALCTSTAIKSNAANHN
SIVVPKSKYSTTKPLSAVLHRTRSELGMTPKAKKRARELLELEETTLELSSIHIQDSSLS
LLGFHSDSDKDRHLMPPPTGQEPRQASSQNSTLMGIVEETEPKESSKVQQSMVAPTVPTT
VRCQLFNTTISPISLRASSSQRELSGIQPMEETVVASPQQPCLRRSVRLASSMRSQNYGA
IPKVMNLRRSTRLAGIREHATSVVVKNETDAIPHLRSTVQKKRTRNVKPAPKAWMANNTK
CFLDLLNNGNVKQLQEIPGIGPKSAFSLALHRSRLGCFENLFQVKSLPIWSGNKWERFCQ
INCLDT
Download sequence
Identical sequences P18105 X2JEV2
FBpp0073363 NP_001285129.1.81976 NP_511125.2.81976 7227.FBpp0073363 FBpp0073363 FBpp0073363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]