SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073412 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073412
Domain Number 1 Region: 176-300
Classification Level Classification E-value
Superfamily TPR-like 2.2e-22
Family Tetratricopeptide repeat (TPR) 0.001
Further Details:      
 
Domain Number 2 Region: 42-102,135-160
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000275
Family FKBP immunophilin/proline isomerase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073412   Gene: FBgn0030345   Transcript: FBtr0073568
Sequence length 331
Comment type=protein; loc=X:join(11763280..11763372,11763482..11763691,11763773..11764465); ID=FBpp0073412; name=CG1847-PB; parent=FBgn0030345,FBtr0073568; dbxref=FlyBase:FBpp0073412,FlyBase_Annotation_IDs:CG1847-PB,GB_protein:AAN09304.1,REFSEQ:NP_727574,GB_protein:AAN09304,FlyMine:FBpp0073412,modMine:FBpp0073412; MD5=e2610d1a29441e17be80c185dc2af567; length=331; release=r5.30; species=Dmel;
Sequence
MQSRSKSDMKPIRKEILNPGNAYIELTPGTRRLTPHDIGLFQVKFHFQTRRAGDSRIIDD
SRKMEKPMELVLGKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKP
EERRHCCGMTLQNEGIGYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKML
ATSTLRERGNNFYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNY
AQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDAS
LKSTVSKELKSIEDQQQARNVQDRIHMQKLF
Download sequence
Identical sequences FBpp0073412 7227.FBpp0073412 FR686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]