SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073424 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073424
Domain Number 1 Region: 110-254
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-31
Family Fucose binding lectin 0.00057
Further Details:      
 
Domain Number 2 Region: 275-407
Classification Level Classification E-value
Superfamily C-type lectin-like 1.19e-24
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 524-592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 407-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000025
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 899-968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 6 Region: 641-710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000877
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 952-1015
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 840-904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 576-640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000431
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 464-534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 11 Region: 795-850
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000027
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 12 Region: 699-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 13 Region: 57-112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000114
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073424   Gene: FBgn0001083   Transcript: FBtr0073580
Sequence length 1174
Comment type=protein; loc=X:complement(11887530..11887663,11887825..11888349,11888410..11888763,11888848..11888960,11889027..11889153,11889218..11889397,11889496..11889904,11889969..11890264,11890425..11890601,11890674..11890823,11890889..11891041,11891121..11891595,11892271..11892533,11895961..11896129); ID=FBpp0073424; name=fw-PA; parent=FBgn0001083,FBtr0073580; dbxref=FlyBase:FBpp0073424,FlyBase_Annotation_IDs:CG1500-PA,GB_protein:AAF48125.2,REFSEQ:NP_511136,GB_protein:AAF48125,FlyMine:FBpp0073424,modMine:FBpp0073424; MD5=3cd7716ffcbcf45005966c730cee4e0b; length=1174; release=r5.30; species=Dmel;
Sequence
MFCCNIPVDASVATSTSTSISTYPLQRATKRAMTPPNAMALIMLLLLALCAAGNGQICGP
PAVPLNAKVRTITVDSQIAEAHYECDAGYELFGPSAVKCDRRTGWDRDLPFCGVNVAYRK
PVNQSSYTRSGPASYANDGKPGNKNPDGQECSETQKEPSPWWRVDLLTPQAVHVVRITTR
GCCGHQPLQDLEIRVGNSSADLQRNPLCAWYPGTLDEGVVKTFTCARPLVGQYVAIQLVG
VEGSLSLCEVETFTNDEFSVDRCLSPKIGVDTVVTTFSKTCYDFHITKGESFDKAQAICK
QTGGDLVHDFRGATSSYILSELERRKSELKPQLVWIGAQKEPGITSRTWKWVNGDVVQKP
TWGKDQPNNYNGEQNCVVLDGGRNWLWNDVGCNLDYLHFICQHSPLSCGSPDAQQNTTVM
GKKFTLGEKIQYTCPKGHSLLGQTERECRLDGTWSGSSPTCKYVDCGSLPELKFGSIHMS
EERTSFGVVATYSCHENYTLIGNENRTCAMDGWSGKQPECLVDWCPDPQPIAGGDVRFND
KRAGSTATYVCEPGYVLVGEAIISCGLGGEWSSKTPSCRFVDCGAPARPNRGIAILLNGT
TTVNSVVKYECDEDHWLDGQSELYCTREGKWSGEAPVCELVTCETPSVPSGSFVIGYDYN
VHSKIQYNCDPGHIMHGTPVLECLDSGEWSADAPYCEYIDCGTILPIPYGSHKYVTNTTY
VGSEVVFSCSQSHKLSGVLKRTCLESAVWSDASPKCEEIRCPEPKLAAHSLLSVTGNDRM
YGRTLIRTSESSQNTAQTYKIGALAKYRCERGYKMVGEALATCTDSGQWSGTIPECVYVE
CGAPEGINNGKVVLATNATYYGAAVLYECNVNFKLNGVSRRLCTEHGNWSHEAPECVEVV
CDTPNINENLIVEAGPRAVGSVATFKCAKGRIMMGNDTRVCQKNGKWTGKSPTCRPVDCG
RPLAIENGRVIVVNDSTLYGGSAEYHCIPNYNRIGQYLRKCTEDGAWSGKQPRCELATAE
GQETSELGTGVGIGATVIVALLVIFGLIFLYRNKARPVKNTENVQAAETKDERNAAVMSY
STLEANNRMHMDNNPSATFNTFHGGAGGRSNGGGNPDANSNGERLNNNRSENIYDQIPNE
QFYDAPYEMRTNDEVYEPEPVASNVITINGISVR
Download sequence
Identical sequences Q9VYR4
FBpp0111718 7227.FBpp0073424 NP_001285146.1.81976 NP_511136.2.81976 FBpp0073424 FBpp0073424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]