SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073678 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073678
Domain Number 1 Region: 201-462
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 6e-42
Family ATP-dependent DNA ligase catalytic domain 0.0012
Further Details:      
 
Domain Number 2 Region: 471-614
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.51e-19
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0052
Further Details:      
 
Domain Number 3 Region: 657-752
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000121
Family DNA topoisomerase II binding protein 1, TopBP1 0.049
Further Details:      
 
Domain Number 4 Region: 121-226
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000288
Family ATP-dependent DNA ligase DNA-binding domain 0.018
Further Details:      
 
Domain Number 5 Region: 828-917
Classification Level Classification E-value
Superfamily BRCT domain 0.00000247
Family DNA-repair protein XRCC1 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073678   Gene: FBgn0030506   Transcript: FBtr0073847
Sequence length 918
Comment type=protein; loc=X:complement(13558829..13560196,13560259..13561169,13561229..13561393,13561461..13561773); ID=FBpp0073678; name=Lig4-PA; parent=FBgn0030506,FBtr0073847; dbxref=FlyBase:FBpp0073678,FlyBase_Annotation_IDs:CG12176-PA,GB_protein:AAF48298.1,REFSEQ:NP_572907,GB_protein:AAF48298,FlyMine:FBpp0073678,modMine:FBpp0073678; MD5=33fd867e90f88c8951acfb0407ab9b17; length=918; release=r5.30; species=Dmel;
Sequence
MSVDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPE
DGASSFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRLQHRNGNMYR
DYGDVVYSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTEVKQQQLIRFTEQASPEEQKWL
IRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSSKDSKAA
VKFVNLNSVIRPFHQIRPMLCERFPGDIQELMQSDVLYLETKMDGERFQLHIDRGRFMYI
SRNGVDYTRNFGHSYDHGTLTPKLRGLLPLGLESIILDGEMMVWDTNKLRFREKGENTDV
KSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGVLQLMRARKIGSV
QEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGLITEFDVLIIGAF
YNRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQRGVLNHTLKPHWHDVVNEP
PPLWFHYKPKERSGCPDLWIEPQNSVILQVKAADLAPNGAFFTRKSLHFPRTEMKRDDKT
WSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRKQMRMTPSERSRLGLAVYEKRYD
ASTSASTSKLFDGLSFCILSGSAGRHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDE
TFLVKRLILQQPRTCDIVRMEWLLRVCQKQELELKPRDLIAATEPLQQDLAECFDRHGDS
YTKDIANVEELQDLLQGIELTADNVAGITASNLNALEDQLLDGKKNLNMFRNLNAFFYSP
HGDEVAKLLFLQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLTTDKVLNSA
WIHQCHREGILLPMHSFV
Download sequence
Identical sequences Q9VYA5
NP_572907.1.81976 FBpp0073678 7227.FBpp0073678 FBpp0073678 FBpp0073678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]