SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073714 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073714
Domain Number 1 Region: 400-659
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-47
Family YWTD domain 0.00000467
Further Details:      
 
Domain Number 2 Region: 736-951
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-18
Family YWTD domain 0.002
Further Details:      
 
Domain Number 3 Region: 1489-1731
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-17
Family YWTD domain 0.0017
Further Details:      
 
Domain Number 4 Region: 1156-1192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 346-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000013
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 6 Region: 1385-1424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000168
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 1282-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 8 Region: 1193-1232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 1071-1109
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 10 Region: 88-124
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 11 Region: 1411-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000724
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 12 Region: 224-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 1116-1152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 14 Region: 182-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 15 Region: 1336-1372
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 16 Region: 1241-1279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 17 Region: 1032-1063
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000392
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 18 Region: 269-303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000851
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 19 Region: 128-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000969
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 20 Region: 309-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000686
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  FBpp0073714
Domain Number - Region: 665-706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000217
Family EGF-type module 0.0078
Further Details:      
 
Domain Number - Region: 985-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073714   Gene: FBgn0004649   Transcript: FBtr0073897
Sequence length 1937
Comment type=protein; loc=X:join(14087412..14087784,14088046..14088459,14088531..14091080,14091143..14093619); ID=FBpp0073714; name=yl-PA; parent=FBgn0004649,FBtr0073897; dbxref=FlyBase:FBpp0073714,FlyBase_Annotation_IDs:CG1372-PA,GB_protein:AAF48349.2,REFSEQ:NP_511151,GB_protein:AAF48349,FlyMine:FBpp0073714,modMine:FBpp0073714; MD5=caf94ca5a9ff9d3050ef7611628665ad; length=1937; release=r5.30; species=Dmel;
Sequence
MCQAEHQVHPSEQRIRVESPKMTASRRGFNLTSQTRAHPSSGGSTSSRYGNCQRTHLIIN
GRHVAISLLLLVGLCGGTAAGTPGSADTRCDAGQFQCRDGGCILQAKMCDGRGDCKDSSD
ELDCDYRLCRPPHWFPCAQPHGACLAAELMCNGIDNCPGGEDELNCPVRPGFRFGDTAHR
MRSCSKYEFMCQQDRTCIPIDFMCDGRPDCTDKSDEVAGCKQAEITCPGEGHLCANGRCL
RRKQWVCDGVDDCGDGSDERGCLNLCEPQKGKFLCRNRETCLTLSEVCDGHSDCSDGSDE
TDLCHSKPDCDAKKCALGAKCHMMPASGAECFCPKGFRLAKFEDKCEDVDECKEQDDLCS
QGCENTSGGYRCVCDAGYLLDKDNRTCRAVVYGSKEQQPLLLYTTQMTIMGMHLREDNVR
NHVYQVAGNLSKVIGVAYDGSHIYWTNIQNEAESIVKANGDGSNAEILLTSGLDAPEDLA
VDWLTQNIYFSDNIMRHIAVCSNDGLNCAVLVTQDVHQPRSLAVWPQKGLMFWTDWGEKP
MIGRASMDGSRSRPIVSDNIEWPNGIALDMHQQRIYWVDAKLGSVQTVRPDGTGRRTVLD
GMLKHPYGLAIFEDQLYWSDWATKSVHACHKFSGKDHRILAKDRTIYAVHIYHPAKQPNS
PHGCENATCSHLCLLAEPEIGGHSCACPDGMRLAPDHRRCMLMEKRQRLFIGLGQVLLEI
EHTAFGRHQVSKSYTLPCLINEMVYNRINGSLIIADNDQRLILEFQPESHESNVLVRSNL
GNVSALAFDHLSRNLYWADTERAVIEVLSLQTRHRALIRFFPGQEVPIGLTVMPAEGYLY
VVLKAKRHSHIDKIPLSGKGEQVHVFEDDLGDDDIKLVTDYETQTIFWSDSDLGRISYSN
YRVPHSQIFRGKLRRPYSLAMVHHDLFWNELGTPRIYWTHKSNMGPRKVIDIMEKDDPAA
IMPYVPVATPNGIPLAASSPVGQESHPCQQQNGGCSHICVGEGPYHSICLCPAGFVYRDA
GNRTCVEALDCEFRCHSGECLTMNHRCNGRRDCVDNSDEMNCDEEHRRKPKVLCSPNQFA
CHSGEQCVDKERRCDNRKDCHDHSDEQHCEKFDKSKKCHVHQHGCDNGKCVDSSLVCDGT
NDCGDNSDELLCEATSRCEPGMFQCGSGSCIAGSWECDGRIDCSDGSDEHDKCVHRSCPP
DMQRCLLGQCLDRSLVCDGHNDCGDKSDELNCGTDSSTMNISCAEDQYQCTSNLKICLPS
TVRCNGTTECPRGEDEADCGDVCSIYEFKCRSGRECIRREFRCDGQKDCGDGSDELSCEL
EKGHHNQSQIQPWSTSSRSCRPHLFDCQDGECVDLSRVCNNFPDCTNGHDEGPKCATACR
SASGRQVCQHKCRATPAGAVCSCFDGYRLDADQKSCLDIDECQEQQPCAQLCENTLGGYQ
CQCHADFMLRQDRVSCKSLQSGATLLFSSFNEVRNLSEQPVMLNVAWSANDSRITGFDLA
MHRQMGYFSAEDEGIVYQIDLQTKVIVRALGLPAPTKLSVDWVTGNVYVLSGAQEIQACS
FVGRMCGRIVHVKSPRHVKHLAVDGYHARIFYIVIRTEGYGQTSSEIHMARLDGSRRDML
LQRSESFMTALTTDPHQQLLYFVDQHMRTLERISYRLKTGPMRRPEIMLQKSNALMHPSG
LSVYENNAFIVNLGSVEAVQCALYGSRICHKISINVLNAQDIVVAGRSRQPQKASHPCAH
AHCHGLCLQADYGYECMCGNRLVAEGERCPHGSGNEVAVLGAVNSLELEHEHEQNGHFHW
LMALFVLAAGSLIAGLGYMYYQYRQRGHTDLNINMHFQNPLATLGGTKAFLEHERAEAGV
GFTTETGTVSSRGSNDTFTTTSATSSFAAQQFSVPNALQRLLRPRQSASGDPMAQELLLE
SPSRVSSDGGQMAVEDM
Download sequence
Identical sequences A0A0D4RRS9
FBpp0073714 FBpp0073714 NP_511151.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]