SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073739 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073739
Domain Number 1 Region: 15-208
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-62
Family Dual specificity phosphatase-like 0.00000173
Further Details:      
 
Domain Number 2 Region: 279-498
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.47e-37
Family mRNA capping enzyme 0.00021
Further Details:      
 
Domain Number 3 Region: 500-603
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.65e-26
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073739   Gene: FBgn0030556   Transcript: FBtr0073922
Sequence length 649
Comment type=protein; loc=X:complement(14134351..14134553,14134621..14134817,14134885..14135158,14135213..14135351,14135414..14136346,14136411..14136614); ID=FBpp0073739; name=mRNA-capping-enzyme-PA; parent=FBgn0030556,FBtr0073922; dbxref=FlyBase:FBpp0073739,GB_protein:AAF48361.1,FlyBase_Annotation_IDs:CG1810-PA,REFSEQ:NP_572952,GB_protein:AAF48361,FlyMine:FBpp0073739,modMine:FBpp0073739; MD5=18183a107eec2b624211c75604ec2263; length=649; release=r5.30; species=Dmel;
Sequence
MALTNRDRERGSGPLPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEML
FEYCKTLKVKLGLWVDLTNTKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIV
DNFINERPFDVIAVHCTHGFNRTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYI
NELYKRYEDTNAAPAAPEQPNWCLDYDDGNGDGFVQDNSSSTSQQAGEQDDDAEEVEGED
AGGDCDASTSDGQPRKKRRREMIIKNATFMAGVPGVRQVSDQPRLGDLQRKVQDWCDWKK
NGFPGAQPVSMDRENIKRLSEIPYRVSWKADGTRYMMLIDGRDEVYFFDRNHSCFQVENV
TFVESRNLNEHLDGTLVDGEMVLDKIGETVTPRYLIYDIVRLSNRDVRDEPFYPNRLDYI
KTEVIGPRILGMKHGIINQRLQAFSVRGKDFWDIWMSARLLGEKFSRTLAHEPDGLIFQP
SKQPYTAGTCSDVFKWKPHELNSVDFRLKIITERGEGLLTKKVGFLYVGGHDAPYGRMQR
LTKETRELDNRIVECTMNQFGNWDFMRERTDKKNPNSYNTARSVVDSIKHPVTKEYLLNF
IASSGYRNDHVMMPPPINSHNQNHNHNHFYPHGHGQHQRRPCVNPTLGN
Download sequence
Identical sequences Q9VY44
NP_572952.1.81976 FBpp0073739 FBpp0073739 FBpp0073739 7227.FBpp0073739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]