SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073947 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073947
Domain Number 1 Region: 256-409
Classification Level Classification E-value
Superfamily ARM repeat 5.47e-28
Family MIF4G domain-like 0.009
Further Details:      
 
Domain Number 2 Region: 4-100
Classification Level Classification E-value
Superfamily Translation initiation factor 2 beta, aIF2beta, N-terminal domain 4.19e-24
Family Translation initiation factor 2 beta, aIF2beta, N-terminal domain 0.0048
Further Details:      
 
Domain Number 3 Region: 97-130
Classification Level Classification E-value
Superfamily Zinc-binding domain of translation initiation factor 2 beta 0.00000641
Family Zinc-binding domain of translation initiation factor 2 beta 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073947   Gene: FBgn0030719   Transcript: FBtr0074144
Sequence length 464
Comment type=protein; loc=X:complement(15881318..15882022,15882101..15882577,15882650..15882862); ID=FBpp0073947; name=eIF5-PA; parent=FBgn0030719,FBtr0074144; dbxref=FlyBase:FBpp0073947,FlyBase_Annotation_IDs:CG9177-PA,GB_protein:AAF48553.1,REFSEQ:NP_727922,GB_protein:AAF48553,FlyMine:FBpp0073947,modMine:FBpp0073947; MD5=c8b05d868e791e75a06baf979dd74b31; length=464; release=r5.30; species=Dmel;
Sequence
MATVNVNRSVTDIFYRYKMPRLQAKVEGKGNGIKTVLVNMAEVARAIGRPATYPTKYFGC
ELGAQTLFDHKNERFVVNGSHDVNKLQDLLDGFIRKFVLCPECDNPETNLTVSAKNQTIS
QSCKACGFHGLLKVNHKVNTFIVKNPPSLNPAAQGSSLTEGKRSRKQKQKNDNADGSMTN
NSLANNSGGESDGGNGTNQASQTEAEISAAIPEKTAKDDDDEGWSVDVSKEAIRARLQDL
TDGAKGMTISDDYDKTEKERIDIFYELVKDKRDKKQLDDVQTHKELVIEAERLDIINKAP
LVLAELLFTENIIKDVQKNRPLLLRFTLNNPKAQRYLIGGVEQTVELHKGILMSKVAGIF
KLFYDLDILDEAVILEWAQKVSKRHVSKNIAAEIHEKAMPFVLWLKNAEEESSESEEEED
DESEEDNYVSSAGQRGGQRVVQRGIPRAVAGDEDDEDDVNIDDI
Download sequence
Identical sequences Q9VXK6
FBpp0073947 FBpp0073948 FBpp0089136 FBpp0089137 FBpp0089138 FBpp0089139 FBpp0089140 7227.FBpp0073948 NP_573098.1.81976 NP_727922.1.81976 NP_996477.1.81976 NP_996478.1.81976 NP_996479.1.81976 NP_996480.1.81976 NP_996481.1.81976 FBpp0073947 FBpp0073948 FBpp0089136 FBpp0089137 FBpp0089138 FBpp0089139 FBpp0089140 7293169___KOG2767 FBpp0073947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]