SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0073973 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0073973
Domain Number 1 Region: 124-172
Classification Level Classification E-value
Superfamily RING/U-box 1.44e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0073973   Gene: FBgn0030693   Transcript: FBtr0074188
Sequence length 277
Comment type=protein; loc=X:complement(15688134..15688234,15688300..15688466,15688530..15689095); ID=FBpp0073973; name=CG8974-PD; parent=FBgn0030693,FBtr0074188; dbxref=GB_protein:AAS65349.1,FlyBase:FBpp0073973,FlyBase_Annotation_IDs:CG8974-PD,REFSEQ:NP_996449,GB_protein:AAS65349; MD5=ff369f7902802a2b6d9a16ae5c49cc86; length=277; release=r5.30; species=Dmel;
Sequence
MEEPKSVPTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTS
IPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADD
SLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGR
NSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGE
PRPPAANRGTRQYEDEQTLSKLFSYLAVVWILWLFYA
Download sequence
Identical sequences Q9VXP1
NP_573076.1.81976 NP_727896.1.81976 NP_727897.1.81976 NP_996448.1.81976 NP_996449.1.81976 FBpp0073970 FBpp0073971 FBpp0073972 FBpp0073973 FBpp0073974 FBpp0073970 FBpp0073971 FBpp0073972 FBpp0073973 FBpp0073974 7227.FBpp0073972 FBpp0073970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]