SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074039 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074039
Domain Number 1 Region: 371-711
Classification Level Classification E-value
Superfamily Subtilisin-like 1.03e-87
Family Subtilases 0.00000000103
Further Details:      
 
Domain Number 2 Region: 705-854
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-39
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1010-1171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.86e-32
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 4 Region: 1304-1456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.15e-25
Family Growth factor receptor domain 0.00058
Further Details:      
 
Domain Number 5 Region: 1159-1307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.16e-24
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 6 Region: 239-310
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.57e-23
Family Prohormone convertase 1 pro-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0074039
Domain Number - Region: 1559-1638
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.0288
Family Flagellar hook protein flgE 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074039   Gene: FBgn0004598   Transcript: FBtr0074262
Sequence length 1679
Comment type=protein; loc=X:join(16269089..16269892,16269958..16270062,16270125..16270373,16270686..16270820,16270881..16271040,16271101..16271404,16271456..16272679,16272740..16272927,16272997..16273153,16273222..16273496,16273595..16273880,16273955..16274154,16274221..16274508,16274571..16274794,16274860..16275300); ID=FBpp0074039; name=Fur2-PD; parent=FBgn0004598,FBtr0074262; dbxref=FlyBase:FBpp0074039,FlyBase_Annotation_IDs:CG18734-PD,GB_protein:AAN09400.1,REFSEQ:NP_523368,GB_protein:AAN09400,FlyMine:FBpp0074039,modMine:FBpp0074039; MD5=51fe0fb75ad1ff59b42eca952bcd07f8; length=1679; release=r5.30; species=Dmel;
Sequence
MSNTTRSSRVTIGRIGTTPQITDPWSSGLEKQRPSRCGGPKSLAEPTYRKIGRRKMMLHM
RVHDPGTTVTQRAKETATAKLNRIYLCTFNRMAQSCIYFVLFLVILSPNTSCALRSSAGE
TQNYVGILSNDSATTTYDVSSLHSSRRTNPPSSSSSSSSNVDVDYRNDRELHKVDLVGLG
GERAGQAETISGGKYDYNYENTHTNASAKDEIVERQSNSLDFDGVDMFGAFSIPEEAIYT
NEFAVNIPAGKQMADVIATKHGFINRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKS
ENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASH
SQRMEYRDVSSHFIFPDPLFKEQWYLNGGAKDGLDMNVGPAWQKGYTGKGVVVSILDDGI
QTNHPDLAQNYDPEASFDINGNDSDPTPQDNGDNKHGTRCAGEVAAVAFNNFCGVGVAYN
ASIGGVRMLDGKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFIYGV
TSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSSTLA
TTYSSGTPGHDKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPELTWR
DMQYLVVYTSRPAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQHIC
KSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRILLT
SPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPGILS
KWQLIFYGTSTQPMRLKSELLNSSPQLRSPSSSNPFLFPSASNIGQPANEGGNFNTDSFA
SYLNYQNIFSSAGSDPEPATATLDGQNVTAAIAGGSSAESLGFTASAAQLVAAPETRDGD
KKILHSCDAECDSSGCYGRGPTQCVACSHYRLDNTCVSRCPPRSFPNQVGICWPCHDTCE
TCAGAGPDSCLTCAPAHLHVIDLAVCLQFCPDGYFENSRNRTCVPCEPNCASCQDHPEYC
TSCDHHLVMHEHKCYSACPLDTYETEDNKCAFCHSTCATCNGPTDQDCITCRSSRYAWQN
KCLISCPDGFYADKKRLECMPCQEGCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEGCSE
SEFYSQVEGQCRPCHASCGSCNGPADTSCTSCPPNRLLEQSRCVSGCREGFFVEAGSLCS
PCLHTCSQCVSRTNCSNCSKGLELQNGECRTTCADGYYSDRGICAKCYLSCHTCSGPRRN
QCVQCPAGWQLAAGECHPECPEGFYKSDFGCQKCHHYCKTCNDAGPLACTSCPPHSMLDG
GLCMECLSSQYYDTTSATCKTCHDSCRSCFGPGQFSCKGCVPPLHLDQLNSQCVSCCQNQ
TLAEKTSSAACCNCDGETGECKATSTGGKRRTVVGSGSAYKSSESKHGSFENDGNAREFV
LRLDSPLTAITAIAVAICLLIITIFSIIFAVLQRNSNHVSRNSVRYRKIANTSSGRRKNL
SAKPTSDARFIFNIGEDDDTDGDNSDDELDGNVGTDINNRIVYDRKGNDHGHEFYIESTN
DIDAIEFHCNGAGAQKAETQLQRCNANGDDDDILHYDRHTNAERKNHPSSTTSRTNIRS
Download sequence
Identical sequences P30432
FBpp0074039 FBpp0074041 FBpp0074043 FBpp0089399 NP_523368.2.81976 NP_727966.1.81976 NP_727967.1.81976 NP_996486.1.81976 FBpp0074039 FBpp0074041 FBpp0074043 FBpp0089399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]