SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0074040 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0074040
Domain Number 1 Region: 371-714
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-86
Family Subtilases 0.0000000012
Further Details:      
 
Domain Number 2 Region: 708-857
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.15e-39
Family Proprotein convertase P-domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1013-1174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.86e-32
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 4 Region: 1307-1459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.09e-25
Family Growth factor receptor domain 0.00058
Further Details:      
 
Domain Number 5 Region: 1162-1310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.67e-24
Family Growth factor receptor domain 0.0013
Further Details:      
 
Domain Number 6 Region: 239-310
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.57e-23
Family Prohormone convertase 1 pro-domain 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0074040
Domain Number - Region: 1562-1641
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.0288
Family Flagellar hook protein flgE 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0074040   Gene: FBgn0004598   Transcript: FBtr0074263
Sequence length 1682
Comment type=protein; loc=X:join(16269089..16269892,16269958..16270062,16270125..16270382,16270686..16270820,16270881..16271040,16271101..16271404,16271456..16272679,16272740..16272927,16272997..16273153,16273222..16273496,16273595..16273880,16273955..16274154,16274221..16274508,16274571..16274794,16274860..16275300); ID=FBpp0074040; name=Fur2-PC; parent=FBgn0004598,FBtr0074263; dbxref=FlyBase:FBpp0074040,FlyBase_Annotation_IDs:CG18734-PC,GB_protein:AAN09399.1,REFSEQ:NP_727965,GB_protein:AAN09399; MD5=86cad23e40c207db216318a878f7a442; length=1682; release=r5.30; species=Dmel;
Sequence
MSNTTRSSRVTIGRIGTTPQITDPWSSGLEKQRPSRCGGPKSLAEPTYRKIGRRKMMLHM
RVHDPGTTVTQRAKETATAKLNRIYLCTFNRMAQSCIYFVLFLVILSPNTSCALRSSAGE
TQNYVGILSNDSATTTYDVSSLHSSRRTNPPSSSSSSSSNVDVDYRNDRELHKVDLVGLG
GERAGQAETISGGKYDYNYENTHTNASAKDEIVERQSNSLDFDGVDMFGAFSIPEEAIYT
NEFAVNIPAGKQMADVIATKHGFINRGQIGSLDNYYLFQHHHVSKRSLRSSRKHQGALKS
ENEVKWMQQQHEKVRRKRDGPYQDLPTYSPYNLLRQHGGYVVDPNPHLSFSPESISLASH
SQRMEYRDVSSHFIFPDPLFKEQWYLVSKNGGAKDGLDMNVGPAWQKGYTGKGVVVSILD
DGIQTNHPDLAQNYDPEASFDINGNDSDPTPQDNGDNKHGTRCAGEVAAVAFNNFCGVGV
AYNASIGGVRMLDGKVNDVVEAQALSLNPSHIDIYSASWGPEDDGSTVDGPGPLARRAFI
YGVTSGRQGKGSIFVWASGNGGRYTDSCNCDGYTNSIFTLSISSATQAGFKPWYLEECSS
TLATTYSSGTPGHDKSVATVDMDGSLRPDHICTVEHTGTSASAPLAAGICALALEANPEL
TWRDMQYLVVYTSRPAPLEKENGWTLNGVKRKYSHKFGYGLMDAGAMVSLAEQWTSVPPQ
HICKSRENNEDRKIDGAYGSTLSTHMDVNGCAGTINEVRYLEHVQCRITLRFFPRGNLRI
LLTSPMGTTSTLLFERPRDIVKSNFDDWPFLSVHFWGEKAEGRWTLQVINGGRRRVNQPG
ILSKWQLIFYGTSTQPMRLKSELLNSSPQLRSPSSSNPFLFPSASNIGQPANEGGNFNTD
SFASYLNYQNIFSSAGSDPEPATATLDGQNVTAAIAGGSSAESLGFTASAAQLVAAPETR
DGDKKILHSCDAECDSSGCYGRGPTQCVACSHYRLDNTCVSRCPPRSFPNQVGICWPCHD
TCETCAGAGPDSCLTCAPAHLHVIDLAVCLQFCPDGYFENSRNRTCVPCEPNCASCQDHP
EYCTSCDHHLVMHEHKCYSACPLDTYETEDNKCAFCHSTCATCNGPTDQDCITCRSSRYA
WQNKCLISCPDGFYADKKRLECMPCQEGCKTCTSNGVCSECLQNWTLNKRDKCIVSGSEG
CSESEFYSQVEGQCRPCHASCGSCNGPADTSCTSCPPNRLLEQSRCVSGCREGFFVEAGS
LCSPCLHTCSQCVSRTNCSNCSKGLELQNGECRTTCADGYYSDRGICAKCYLSCHTCSGP
RRNQCVQCPAGWQLAAGECHPECPEGFYKSDFGCQKCHHYCKTCNDAGPLACTSCPPHSM
LDGGLCMECLSSQYYDTTSATCKTCHDSCRSCFGPGQFSCKGCVPPLHLDQLNSQCVSCC
QNQTLAEKTSSAACCNCDGETGECKATSTGGKRRTVVGSGSAYKSSESKHGSFENDGNAR
EFVLRLDSPLTAITAIAVAICLLIITIFSIIFAVLQRNSNHVSRNSVRYRKIANTSSGRR
KNLSAKPTSDARFIFNIGEDDDTDGDNSDDELDGNVGTDINNRIVYDRKGNDHGHEFYIE
STNDIDAIEFHCNGAGAQKAETQLQRCNANGDDDDILHYDRHTNAERKNHPSSTTSRTNI
RS
Download sequence
Identical sequences FBpp0074038 FBpp0074040 FBpp0074042 7227.FBpp0074040 NP_727963.1.81976 NP_727964.1.81976 NP_727965.1.81976 FBpp0074038 FBpp0074040 FBpp0074042 FBpp0074039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]